DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EndoB and Sh3rf3

DIOPT Version :9

Sequence 1:NP_611410.1 Gene:EndoB / 37218 FlyBaseID:FBgn0034433 Length:390 Species:Drosophila melanogaster
Sequence 2:XP_017457292.1 Gene:Sh3rf3 / 294557 RGDID:1589772 Length:878 Species:Rattus norvegicus


Alignment Length:244 Identity:47/244 - (19%)
Similarity:90/244 - (36%) Gaps:60/244 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   163 ERGILETKRLDLDACKNRVKKARSMLGQQSKDGISPEAVLEQAERDLRV--AQAEFDRQAEITKL 225
            |..:.|:..|||..|                     ...||:.:...:|  .|..|.|:.     
  Rat    38 EEDMDESSLLDLLEC---------------------SVCLERLDTTAKVLPCQHTFCRRC----- 76

  Fly   226 LLDGISTSQASHLRHLHAFIQTQVRYYKQCG--------------DVMEQLQRELANLGGPTPYI 276
             |:.|..|:       |.....:.|....||              |.:.|..|..|:.|...|..
  Rat    77 -LESIVCSR-------HELRCPECRILVGCGVDELPANILLVRLLDGIRQRPRTGASPGSSPPAR 133

  Fly   277 P-LDVNEASASKSNISSGAAARGP-------GNNHSANMAATGHKPNQPMHVSTDQMQRARVLCS 333
            | .....|.|..:..::|:..|.|       |::.|:::.......:.|:..:..|:..|:.|.|
  Rat   134 PGPGTFPALAGGAGGATGSPPRSPVFLSAAAGSSTSSSLCDAATNRSVPVAKNLSQLPYAKALYS 198

  Fly   334 YDAKDHTELNLSANEVIFVTECSPVNEDYMYGKQGLLKGLVPRAFVEML 382
            |:.|:..:|..:..::|.:..  .|:|::.:|:.....|.:|.::::.:
  Rat   199 YEGKEPGDLKFNKGDIIILRR--KVDENWYHGELQGTHGFLPASYIQCM 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EndoBNP_611410.1 BAR_Endophilin_B 26..266 CDD:153278 22/118 (19%)
SH3_Endophilin_B 327..378 CDD:212736 12/50 (24%)
Sh3rf3XP_017457292.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166343645
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.