DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EndoB and Sh3d19

DIOPT Version :9

Sequence 1:NP_611410.1 Gene:EndoB / 37218 FlyBaseID:FBgn0034433 Length:390 Species:Drosophila melanogaster
Sequence 2:XP_006501609.3 Gene:Sh3d19 / 27059 MGIID:1350923 Length:1211 Species:Mus musculus


Alignment Length:376 Identity:79/376 - (21%)
Similarity:127/376 - (33%) Gaps:118/376 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 KLGTTERTEYDLHFQNLAERADVTKTWT----------EKIVRDTESVLIPNPQNRVEDFIFEKI 85
            ||..::.:..:|.|...:...|:.|..:          .:|.::.:.||.|.|  :....::.|.
Mouse   772 KLPASKSSNKNLPFNRSSSDMDLQKKQSHFVSGLSKAKSQIFKNQDPVLPPRP--KPGHPLYRKY 834

  Fly    86 EKSKPKRLSNLEHLALDMIEAGGDFGQDLPYGQALIKVGQAEQKLGQCEHDFIATSGICFTQPLR 150
            ..|.|..::|.:.::.:..|.      ....|..|:.:.|||....:|:..    .|.....|  
Mouse   835 MLSVPHGIANEDIVSRNPTEL------SCKRGDVLVILKQAENNYLECQRG----EGTGRVHP-- 887

  Fly   151 KFLDGEMKTIGKERGILETKRLDLDACKNRVKKARSMLGQQSKDGISPEAV------LEQAERDL 209
                .:||.:           ..||. :.|.:...|...|:..|..:|.||      .|||: ||
Mouse   888 ----SQMKIV-----------TPLDE-RPRGRPNDSGHSQKPVDSGAPHAVALHDFPAEQAD-DL 935

  Fly   210 RVAQAEFDRQAEITKLLLDGISTSQASHLRHLHAFIQTQVRYYKQCGDVMEQLQRELANLGG--P 272
            .:...|.       ..||:.|....                |..:|           .|..|  |
Mouse   936 SLTSGEI-------VYLLEKIDAEW----------------YRGKC-----------RNQTGVFP 966

  Fly   273 TPYIP--LDVNEASASKSNISSGAAARGPGNNHSANMAATGHKPNQPMHVSTDQMQRARVLCSY- 334
            ..|:.  :|:.|..:.|....|...|:||                           |......| 
Mouse   967 ANYVKVIVDIPEGRSGKRESFSSHCAKGP---------------------------RCVARFEYI 1004

  Fly   335 -DAKDHTELNLSANEVIFVTECSPVNEDYMYGKQGLLKGLVPRAFVEMLDE 384
             |.||  ||:.|..|||.:||.  |||::..|:.....|:.|..|||::.:
Mouse  1005 GDQKD--ELSFSEGEVIILTEY--VNEEWGRGEIRDRSGIFPLNFVELVGD 1051

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EndoBNP_611410.1 BAR_Endophilin_B 26..266 CDD:153278 46/250 (18%)
SH3_Endophilin_B 327..378 CDD:212736 19/52 (37%)
Sh3d19XP_006501609.3 PHA03247 <50..375 CDD:223021
PTZ00449 <245..705 CDD:185628
SH3_Eve1_1 840..889 CDD:212748 10/64 (16%)
SH3 920..971 CDD:388381 17/85 (20%)
SH3_Eve1_3 996..1046 CDD:212750 19/53 (36%)
SH3 1086..1135 CDD:388381
SH3 1155..1204 CDD:388381
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167839797
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.