DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment EndoB and Sh3rf2

DIOPT Version :9

Sequence 1:	NP_611410.1	Gene:	EndoB / 37218	FlyBaseID:	FBgn0034433	Length:	390	Species:	Drosophila melanogaster
Sequence 2:	NP_001139771.1	Gene:	Sh3rf2 / 269016	MGIID:	2444628	Length:	735	Species:	Mus musculus

Alignment Length:	71	Identity:	18/71 - (25%)
Similarity:	40/71 - (56%)	Gaps:	4/71 - (5%)

- Green bases have known domain annotations that are detailed below.

  Fly   314 PNQPMHVSTDQMQRARVLCSYDAKDHTELNLSANEVIFVTECSPVNEDYMYGKQGLLKGLVPRAF 378
            |:..:|:  |.:.||:.||:|..|:..:|..:..:||.:..  .::|::..|:...:.|:.|.:.
Mouse   118 PSVRIHM--DGVPRAKALCNYRGKNPGDLKFNKGDVILLRR--QLDENWYQGEINGVSGIFPASS 178

  Fly   379 VEMLDE 384
            ||::.:
Mouse   179 VEVIKQ 184

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
EndoB	NP_611410.1	BAR_Endophilin_B	26..266	CDD:153278
EndoB	NP_611410.1	SH3_Endophilin_B	327..378	CDD:212736	13/50 (26%)
Sh3rf2	NP_001139771.1	RING-HC_SH3RF2	11..55	CDD:319663
		RING-HC finger (C3HC4-type)	12..52	CDD:319663
		SH3_SH3RF2_1	128..181	CDD:212862	14/54 (26%)
		SH3_SH3RF2_2	191..247	CDD:212865
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	262..302
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	333..378
		Interaction with PAK4. /evidence=ECO:0000250\|UniProtKB:Q8TEC5	372..465
		SH3_SH3RF2_3	386..440	CDD:212718
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	497..534
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	612..720
		Interaction with PPP1CA. /evidence=ECO:0000250	647..652
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C167839807
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.930