DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EndoB and mug137

DIOPT Version :9

Sequence 1:NP_611410.1 Gene:EndoB / 37218 FlyBaseID:FBgn0034433 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_588493.1 Gene:mug137 / 2539113 PomBaseID:SPCC1919.11 Length:420 Species:Schizosaccharomyces pombe


Alignment Length:355 Identity:70/355 - (19%)
Similarity:147/355 - (41%) Gaps:43/355 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 ISRVVQLTEEKLGTTERTEYDLHFQNLAERADVTKTWTEKIVRDTESVLIPNPQNRVEDFIFEKI 85
            :||....|.||....:|......|..|.:...:.:....|:.:.| ::.|        |.|.:|:
pombe     2 VSRFFSWTNEKPLGDQRAHLPDSFLELEQEIAIREEGLSKLFQAT-TIWI--------DSILKKV 57

  Fly    86 EKSKPKRLSNLEHLALDMIEAGGDFGQDLPYGQALIKVGQAEQKLGQCEHDFIATSGICFTQPLR 150
            :....::....|:|...||....:..||..||..|.::|:|..|:|:.:......:.:|:...|:
pombe    58 DGEDKEKCLACENLGKVMINHSKELPQDSSYGITLSQLGKANLKIGEHQTSLAYKARVCYLDFLK 122

  Fly   151 KFLDGEMKTIGKERGILETKRLDLDACKNRVKKARSMLGQQSKDGISPEAVLEQAERDLRVAQAE 215
            ::| .:.|.....|..||::|   .|.::.::|:   ..::.:|        .:.|.|:|:|..:
pombe   123 RYL-VQAKDFHSARKKLESRR---QAYESLLQKS---FKEKKED--------SRLEEDIRLALYK 172

  Fly   216 FDRQAEITKLLLDGISTSQASHLRHLHAFIQTQVRYYKQCGDVMEQLQRELANLGGPTPYIPLDV 280
            |:...|..|..:..:...:|...:.|...|..::.::|:...::..:.....:|   ||...:..
pombe   173 FEESTEQVKNRMIALKDVEADQYQQLTELIVYELNFFKESTGILNTIFNSQNSL---TPQKKIQS 234

  Fly   281 NEASASKSNISSGAAARGPGN-------NHSANMAATGHKP-NQPMHVSTDQMQRARVLCSYDAK 337
            :|.|.....::|      |.:       ..:.|.......| :.|...|..:....:.:.|:..:
pombe   235 SERSVENEFLAS------PMDPSLSKLFTKTTNTEKISPTPFSTPKRKSKKETVFVKAIYSFTGR 293

  Fly   338 DHTELNLSANEVIFVTECSPVNEDYMYGKQ 367
            :..||:|...:||.|:|  .:..|:..|::
pombe   294 NEKELDLHTGDVIQVSE--QLGPDWYMGEK 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EndoBNP_611410.1 BAR_Endophilin_B 26..266 CDD:153278 47/239 (20%)
SH3_Endophilin_B 327..378 CDD:212736 10/41 (24%)
mug137NP_588493.1 BAR_MUG137_fungi 17..230 CDD:153277 47/239 (20%)
SH3 280..341 CDD:214620 10/44 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 50 1.000 Domainoid score I3392
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.870

Return to query results.
Submit another query.