DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EndoB and Sh3rf3

DIOPT Version :9

Sequence 1:NP_611410.1 Gene:EndoB / 37218 FlyBaseID:FBgn0034433 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_766376.2 Gene:Sh3rf3 / 237353 MGIID:2444637 Length:878 Species:Mus musculus


Alignment Length:293 Identity:55/293 - (18%)
Similarity:96/293 - (32%) Gaps:104/293 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   154 DGEMKTIGKERGILETKRLDLDACKNRVKKARSMLGQQSKDGISPEAVLEQAERDLRV--AQAEF 216
            :||.:...::||.......|:|        ..|:|     |.:.....||:.:...:|  .|..|
Mouse    21 EGEDRQGEQQRGAQARTEEDMD--------ESSLL-----DLLECSVCLERLDTTAKVLPCQHTF 72

  Fly   217 DRQAEITKLLLDGISTSQASHLRHLHAFIQTQVRYYKQCG--------------DVMEQLQRELA 267
            .|:.      |:.|..|:       |.....:.|....||              |.:.|..|..|
Mouse    73 CRRC------LESIVCSR-------HELRCPECRILVGCGVDELPANILLVRLLDGIRQRPRTGA 124

  Fly   268 NLGGPTPYIPLDVNEASASKSNISSGAAARGPGNNHSANMAATGHKPNQPMHVST---------- 322
            :.|...|..|     ...:.|.::.||.            .|||..|..|:.:|.          
Mouse   125 SPGSSPPARP-----GPGTFSALAGGAG------------GATGSPPCSPVFLSAAAGSSTSSLC 172

  Fly   323 --------------DQMQRARVLCSYDAKDHTELNLSANEVIFVTECSPVNEDYMYGKQGLLKGL 373
                          .|:..|:.|.||:.|:..:|..:..::|.:..  .|:|::.:|:...:.|.
Mouse   173 DVATNRSVPVAKTLSQLPYAKALYSYEGKEPGDLKFNKGDIIILRR--KVDENWYHGELQGMHGF 235

  Fly   374 VPRAFV-------------------EMLDEEHD 387
            :|.:::                   ||.|.:.|
Mouse   236 LPASYIQCVRPLPQALPQGKALYDFEMKDRDQD 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EndoBNP_611410.1 BAR_Endophilin_B 26..266 CDD:153278 25/127 (20%)
SH3_Endophilin_B 327..378 CDD:212736 12/50 (24%)
Sh3rf3NP_766376.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 19..40 4/18 (22%)
RING 51..93 CDD:238093 10/54 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 120..145 6/29 (21%)
SH3 190..243 CDD:302595 12/54 (22%)
SH3 253..307 CDD:302595 4/16 (25%)
Interaction with RAC1. /evidence=ECO:0000250|UniProtKB:Q8TEJ3 364..433
SH3_SH3RF3_3 461..517 CDD:212858
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 574..659
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 688..758
SH3_SH3RF_C 823..877 CDD:212719
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167839805
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.