DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EndoB and Sorbs3

DIOPT Version :9

Sequence 1:NP_611410.1 Gene:EndoB / 37218 FlyBaseID:FBgn0034433 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_035496.1 Gene:Sorbs3 / 20410 MGIID:700013 Length:733 Species:Mus musculus


Alignment Length:187 Identity:39/187 - (20%)
Similarity:77/187 - (41%) Gaps:23/187 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   206 ERDLRVAQAEFDRQAEITKLLLDGISTSQASHLRHLHAFIQTQVRYYKQCGDVMEQLQRELANLG 270
            ||:|....||.|:.....:..|.....|||..            |..:|.| :.:|....|::..
Mouse   334 ERELAKLSAELDKDLRAIETRLPSPKNSQAPR------------RPLEQPG-LEQQPSARLSSAW 385

  Fly   271 GP-TPYIPLDVNEASASKSNISSGAAARGPGNN-----HSANMAATGHKPNQPMHVSTDQMQRAR 329
            .| :|:.|...:....|...::.|..:...|..     .||...:...:.:.|......:.:.||
Mouse   386 RPNSPHAPYFSSSRPLSPHRMADGGGSPFLGRRDFVYPSSAREPSASERGSSPSRKEEKKRKAAR 450

  Fly   330 VLCSYDAKDHTELNLSANEVIFVTECSPVNEDYMYGKQGLLKGLVPRAFVEML--DE 384
            :...:.|:...||:|...:::::.:  .|:::::.|:.....|:.|..:||:|  ||
Mouse   451 LKFDFQAQSPKELSLQKGDIVYIHK--EVDKNWLEGEHHGRLGIFPANYVEVLPADE 505

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EndoBNP_611410.1 BAR_Endophilin_B 26..266 CDD:153278 14/59 (24%)
SH3_Endophilin_B 327..378 CDD:212736 10/50 (20%)
Sorbs3NP_035496.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..51
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 129..165
Sorb 165..214 CDD:128735
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 224..285
PTZ00449 <306..>445 CDD:185628 24/123 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 352..448 18/108 (17%)
Binds to vinculin 444..579 15/64 (23%)
SH3_Vinexin_1 447..501 CDD:212854 12/55 (22%)
SH3_Vinexin_2 521..576 CDD:212857
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 584..672
Binds to SOS. /evidence=ECO:0000250 674..733
SH3_Vinexin_3 676..733 CDD:212851
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167839806
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.