DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EndoB and SH3D19

DIOPT Version :9

Sequence 1:NP_611410.1 Gene:EndoB / 37218 FlyBaseID:FBgn0034433 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_001365050.1 Gene:SH3D19 / 152503 HGNCID:30418 Length:1070 Species:Homo sapiens


Alignment Length:377 Identity:67/377 - (17%)
Similarity:123/377 - (32%) Gaps:120/377 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 KLGTTERTEYDLHFQNLAERADVTKTWT----------EKIVRDTESVLIPNPQNRVEDFIFEKI 85
            ||..|.|:...|.|...:...|:.|..:          .::.::.:.||.|.|  :....::.|.
Human   631 KLSATRRSNKKLPFNRSSSDMDLQKKQSNLATGLSKAKSQVFKNQDPVLPPRP--KPGHPLYSKY 693

  Fly    86 EKSKPKRLSNLEHLALDMIEAGGDFGQDLPYGQALIKVGQAEQKLGQCEHDFIATSGICFTQPLR 150
            ..|.|..::|.:.::.:..|.      ....|..|:.:.|.|....:|:.               
Human   694 MLSVPHGIANEDIVSQNPGEL------SCKRGDVLVMLKQTENNYLECQK--------------- 737

  Fly   151 KFLDGEMKTIGKERGILETKRLDLDACKNRVKKAR---SMLGQQSKDGISPEAVL------EQAE 206
                      |::.|.:...::.:....:...::|   ....|:..|..:|.||:      ||.:
Human   738 ----------GEDTGRVHLSQMKIITPLDEHLRSRPNDPSHAQKPVDSGAPHAVVLHDFPAEQVD 792

  Fly   207 RDLRVAQAEFDRQAEITKLLLDGISTSQASHLRHLHAFIQTQVRYYKQCGDVMEQLQRELANLGG 271
             ||.:...|.       ..||:.|.|.                 :|:  |:...|:        |
Human   793 -DLNLTSGEI-------VYLLEKIDTD-----------------WYR--GNCRNQI--------G 822

  Fly   272 --PTPYIP--LDVNEASASKSNISSGAAARGPGNNHSANMAATGHKPNQPMHVSTDQMQRARVLC 332
              |..|:.  :|:.|....|....|....:|                           .|.....
Human   823 IFPANYVKVIIDIPEGGNGKRECVSSHCVKG---------------------------SRCVARF 860

  Fly   333 SYDAKDHTELNLSANEVIFVTECSPVNEDYMYGKQGLLKGLVPRAFVEMLDE 384
            .|..:...||:.|..|:|.:.|.  |||::..|:.....|:.|..|||.:::
Human   861 EYIGEQKDELSFSEGEIIILKEY--VNEEWARGEVRGRTGIFPLNFVEPVED 910

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EndoBNP_611410.1 BAR_Endophilin_B 26..266 CDD:153278 42/253 (17%)
SH3_Endophilin_B 327..378 CDD:212736 14/50 (28%)
SH3D19NP_001365050.1 PHA03247 <168..649 CDD:223021 6/17 (35%)
SH3_Eve1_1 699..748 CDD:212748 9/79 (11%)
SH3_Eve1_2 779..830 CDD:212749 17/85 (20%)
SH3_Eve1_3 855..905 CDD:212750 14/51 (27%)
SH3_Eve1_4 945..994 CDD:212751
SH3_Eve1_5 1014..1063 CDD:212752
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149745
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.