DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EndoB and LOC101885672

DIOPT Version :9

Sequence 1:NP_611410.1 Gene:EndoB / 37218 FlyBaseID:FBgn0034433 Length:390 Species:Drosophila melanogaster
Sequence 2:XP_021334010.1 Gene:LOC101885672 / 101885672 -ID:- Length:287 Species:Danio rerio


Alignment Length:54 Identity:16/54 - (29%)
Similarity:23/54 - (42%) Gaps:5/54 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   319 HVSTDQMQRARVLCSYDAKDHTELNLSANEVIFVTECSPVNE-DYMYGKQGLLK 371
            ||:.||    ..|..:...|.|...|.|..|:.|..|.|.:: .:...|.|.|:
Zfish    91 HVAPDQ----TTLPPFAIPDLTNSPLYAAVVVPVNTCRPGSDIQFWLKKNGCLR 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EndoBNP_611410.1 BAR_Endophilin_B 26..266 CDD:153278
SH3_Endophilin_B 327..378 CDD:212736 12/46 (26%)
LOC101885672XP_021334010.1 Neuralized 28..178 CDD:311244 16/54 (30%)
zf-C3HC4_3 236..277 CDD:316442
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170583899
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.