DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7461 and Acox3

DIOPT Version :9

Sequence 1:NP_001286611.1 Gene:CG7461 / 37217 FlyBaseID:FBgn0034432 Length:627 Species:Drosophila melanogaster
Sequence 2:XP_006504259.1 Gene:Acox3 / 80911 MGIID:1933156 Length:755 Species:Mus musculus


Alignment Length:444 Identity:108/444 - (24%)
Similarity:171/444 - (38%) Gaps:90/444 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 FFSDVNDAARND---ANSKIDDTTSTALWELGAFGIQVPSEFGGLGLNNTQYGRLCAIVGVNDLG 146
            |...:.....||   |.|...|.....|.||.....:...|:|...:.......|..:|.:|.||
Mouse    47 FKKTIFSTLENDPLFARSYGADLPLEKLRELNFLRCKRVFEYGFFKVEELLKNPLKILVLINCLG 111

  Fly   147 LGITIGAHQSIGFKGILLYGT------PEQKEKYLPKVAAEQVYAAFALTEPSSGSDAGSIRCRA 205
            :.....|::.:  ..:|::||      .|:..|||.|:.:.:::..|||||.|.||:..::|..|
Mouse   112 MYDWSLANKCV--LHMLVFGTTVFVSGSEKHFKYLEKIYSLEIFGCFALTELSHGSNTKAMRTTA 174

  Fly   206 VKSADGKHYVLN-----GSKIWISN-GGIAEIMTVFAQTEQVDPKTGEKKDKVTAFIVE------ 258
            ....|.:.::|:     .:|.|:.| |..|....||||....|.:.    ..:.:|:|:      
Mouse   175 HYDPDTQEFILHSPDFEAAKFWVGNLGKTATHAVVFAQLYMPDGQC----HGLHSFLVQIRDTKT 235

  Fly   259 -RSFGGVTNGPPEKKMGIKASNTAEVYFEDVKIPIENVLGKEGDGFKVAMNILNNGRFG------ 316
             ....||..|...||:|....:.....|..|:||.:|:|.:.|       ||.:.|.:.      
Mouse   236 LLPMTGVMVGDIGKKLGQNGLDNGFAMFNKVRIPRQNLLDRTG-------NITSEGTYNSPFKDV 293

  Fly   317 ---MGATL----SG----------TMKKCIEQATEHANNRVQFGQKLKNYGSIQE-KLAQMNIL- 362
               :||:|    ||          .:|..:..|...:..|.|||...|....:.| .|.|..|| 
Mouse   294 RQRLGASLGSLSSGRISIISMSVVNLKLAVSIAIRFSATRCQFGPTDKEEIPVLEYPLQQWRILP 358

  Fly   363 ----QYATESMAFTI-----------------SQNMDAGSKDYHLEAAISKIYASESAWYVCDEA 406
                .||.:..:.||                 .|..:.| ::.|..|:..|..||.:|.....|.
Mouse   359 YLAAAYALDHFSKTIFMDLIEVQSARLRGDHSDQQAELG-REIHALASAGKPLASWTAQRGIQEC 422

  Fly   407 IQILGGMGYMVDNGLERVLRDLRIFRIFEGTNDILRLFIALTGIQYAGSHLKEL 460
            .:..||.||:..|....:..|......:||.|::|        :|...::|..|
Mouse   423 REACGGHGYLAMNRFGDLRNDNDPNCTYEGDNNVL--------LQQTSNYLLSL 468

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7461NP_001286611.1 VLCAD 45..454 CDD:173850 106/436 (24%)
CaiA 67..446 CDD:224871 105/428 (25%)
Acox3XP_006504259.1 AXO 19..663 CDD:173839 108/444 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1960
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.