DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7461 and Acads

DIOPT Version :9

Sequence 1:NP_001286611.1 Gene:CG7461 / 37217 FlyBaseID:FBgn0034432 Length:627 Species:Drosophila melanogaster
Sequence 2:NP_071957.1 Gene:Acads / 64304 RGDID:620514 Length:414 Species:Rattus norvegicus


Alignment Length:367 Identity:134/367 - (36%)
Similarity:194/367 - (52%) Gaps:32/367 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 AARNDANSKIDDTTSTALWELGAFGIQVPSEFGGLGLNNTQY-------GRLCAIVGV-----ND 144
            ||:.|.......:....:.|||...:.||.|..|.||:...|       .|.||..||     |.
  Rat    59 AAQLDKEHLFPTSQVKKMGELGLLAMDVPEELSGAGLDYLAYSIALEEISRGCASTGVIMSVNNS 123

  Fly   145 LGLGITIGAHQSIGFKGILLYGTPEQKEKYLPKVAAEQVYAAFALTEPSSGSDAGSIRCRAVKSA 209
            |.||            .||.:|:.:||::::...........|||:||.:|||||:....|  ..
  Rat   124 LYLG------------PILKFGSSQQKQQWITPFTNGDKIGCFALSEPGNGSDAGAASTTA--RE 174

  Fly   210 DGKHYVLNGSKIWISNGGIAEIMTVFAQTEQVDPKTGEKKDKVTAFIVERSFGGVTNGPPEKKMG 274
            :|..:||||:|.||:|...|....|||.|::.....|     ::||:|.....|:|.|..|.|:|
  Rat   175 EGDSWVLNGTKAWITNSWEASATVVFASTDRSRQNKG-----ISAFLVPMPTPGLTLGKKEDKLG 234

  Fly   275 IKASNTAEVYFEDVKIPIENVLGKEGDGFKVAMNILNNGRFGMGATLSGTMKKCIEQATEHANNR 339
            |:||:||.:.|||.:||.||:||:.|.|||:||..|:.||.|:.:...|..:..::.|.::|.||
  Rat   235 IRASSTANLIFEDCRIPKENLLGEPGMGFKIAMQTLDMGRIGIASQALGIAQASLDCAVKYAENR 299

  Fly   340 VQFGQKLKNYGSIQEKLAQMNILQYATESMAFTISQNMDAGSKDYHLEAAISKIYASESAWYVCD 404
            ..||..|....:||.|||.|.:...:...:.:..:...| ..|.:..|:|::|:.|||:|..:..
  Rat   300 HAFGAPLTKLQNIQFKLADMALALESARLLTWRAAMLKD-NKKPFTKESAMAKLAASEAATAISH 363

  Fly   405 EAIQILGGMGYMVDNGLERVLRDLRIFRIFEGTNDILRLFIA 446
            :||||||||||:.:...||..||.||..|:|||::|.||.||
  Rat   364 QAIQILGGMGYVTEMPAERYYRDARITEIYEGTSEIQRLVIA 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7461NP_001286611.1 VLCAD 45..454 CDD:173850 134/367 (37%)
CaiA 67..446 CDD:224871 132/365 (36%)
AcadsNP_071957.1 CaiA 35..414 CDD:224871 134/367 (37%)
SCAD_SBCAD 38..410 CDD:173847 134/367 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1960
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.