DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7461 and CG6638

DIOPT Version :9

Sequence 1:NP_001286611.1 Gene:CG7461 / 37217 FlyBaseID:FBgn0034432 Length:627 Species:Drosophila melanogaster
Sequence 2:NP_648239.1 Gene:CG6638 / 38979 FlyBaseID:FBgn0035911 Length:420 Species:Drosophila melanogaster


Alignment Length:366 Identity:126/366 - (34%)
Similarity:200/366 - (54%) Gaps:35/366 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 LWELGAFGIQVPSEFGGLGLNNTQYGRLCAIV-------GVNDLGLGITIGAHQSIGFKGILLYG 166
            |..||..||....:|||.|   ..|...|.|:       |    |:.::.|||.::....:...|
  Fly    81 LGALGFLGITAEPDFGGTG---GSYLDHCIIMEEFSRAAG----GVALSYGAHSNLCINQLTKNG 138

  Fly   167 TPEQKEKYLPKVAAEQVYAAFALTEPSSGSDAGSIRCRAVKSADGKHYVLNGSKIWISNGGIAEI 231
            |||||||||||:.:.:.....|::||.:|||..|::.||.:..|  :|||||||.||:||..|:.
  Fly   139 TPEQKEKYLPKLCSGEHVGGLAMSEPGAGSDVVSMKLRAERKGD--YYVLNGSKFWITNGSDADT 201

  Fly   232 MTVFAQT--EQVDPKTGEKKDKVTAFIVERSFGGVTNGPPEKKMGIKASNTAEVYFEDVKIPIEN 294
            :.|:|:|  ..|..|.|     :||||||.::.|.:......|:|::.|:|.|:.|:|:|:|.:|
  Fly   202 LIVYAKTGGSGVPDKHG-----ITAFIVETAWEGFSVAQKLDKLGMRGSSTCELVFQDLKVPAKN 261

  Fly   295 VLGKEGDGFKVAMNILNNGRFGMGATLSGTMKKCIEQATEHANNRVQFGQKLKNYGSIQEKLAQM 359
            :||:|..|..|.|:.|:..|..:.|...|.|:...:.|.::|:.|.|..:.:..:..:|.|:|.|
  Fly   262 ILGQENRGVYVLMSGLDFERLVLAAGPVGLMQAACDVAFDYAHQRKQMNKLIGEFQLLQGKMADM 326

  Fly   360 NILQYATESMAFTISQNMDAGSKDYHLEAAISKIYASESAWYVCDEAIQILGGMGYMVDNGLERV 424
            .....|..|..:|::::.|||::. ..:.|...:|.:|.|..|..:|||||||.||:.:|...|:
  Fly   327 YTTLSACRSYLYTVARSCDAGNRS-PKDCAGVILYTAEKATKVALDAIQILGGNGYINENPTGRI 390

  Fly   425 LRDLRIFRIFEGTNDILRLFIALTGIQYAGSHLKELQRAFK 465
            |||.:::.|..||::|.|..|.           ::|.:.:|
  Fly   391 LRDAKLYEIGAGTSEIRRWLIG-----------RQLNQEYK 420

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7461NP_001286611.1 VLCAD 45..454 CDD:173850 124/353 (35%)
CaiA 67..446 CDD:224871 123/345 (36%)
CG6638NP_648239.1 PLN02519 14..418 CDD:215284 125/362 (35%)
IVD 38..417 CDD:173845 125/361 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460753
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1960
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 183 1.000 Inparanoid score I179
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm9754
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR43884
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.890

Return to query results.
Submit another query.