DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7461 and ACADS

DIOPT Version :9

Sequence 1:NP_001286611.1 Gene:CG7461 / 37217 FlyBaseID:FBgn0034432 Length:627 Species:Drosophila melanogaster
Sequence 2:NP_000008.1 Gene:ACADS / 35 HGNCID:90 Length:412 Species:Homo sapiens


Alignment Length:347 Identity:131/347 - (37%)
Similarity:187/347 - (53%) Gaps:32/347 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 LGAFGIQVPSEFGGLGLNNTQY-------GRLCAIVGV-----NDLGLGITIGAHQSIGFKGILL 164
            ||...:.||.|.||.||:...|       .|.||..||     |.|.||            .||.
Human    77 LGLLAMDVPEELGGAGLDYLAYAIAMEEISRGCASTGVIMSVNNSLYLG------------PILK 129

  Fly   165 YGTPEQKEKYLPKVAAEQVYAAFALTEPSSGSDAGSIRCRAVKSADGKHYVLNGSKIWISNGGIA 229
            :|:.|||:.::....:......|||:||.:|||||:....|  .|:|..:||||:|.||:|...|
Human   130 FGSKEQKQAWVTPFTSGDKIGCFALSEPGNGSDAGAASTTA--RAEGDSWVLNGTKAWITNAWEA 192

  Fly   230 EIMTVFAQTEQVDPKTGEKKDKVTAFIVERSFGGVTNGPPEKKMGIKASNTAEVYFEDVKIPIEN 294
            ....|||.|::.....|     ::||:|.....|:|.|..|.|:||:.|:||.:.|||.:||.::
Human   193 SAAVVFASTDRALQNKG-----ISAFLVPMPTPGLTLGKKEDKLGIRGSSTANLIFEDCRIPKDS 252

  Fly   295 VLGKEGDGFKVAMNILNNGRFGMGATLSGTMKKCIEQATEHANNRVQFGQKLKNYGSIQEKLAQM 359
            :||:.|.|||:||..|:.||.|:.:...|..:..::.|..:|.||:.||..|.....||.|||.|
Human   253 ILGEPGMGFKIAMQTLDMGRIGIASQALGIAQTALDCAVNYAENRMAFGAPLTKLQVIQFKLADM 317

  Fly   360 NILQYATESMAFTISQNMDAGSKDYHLEAAISKIYASESAWYVCDEAIQILGGMGYMVDNGLERV 424
            .:...:...:.:..:...| ..|.:..|||::|:.|||:|..:..:||||||||||:.:...||.
Human   318 ALALESARLLTWRAAMLKD-NKKPFIKEAAMAKLAASEAATAISHQAIQILGGMGYVTEMPAERH 381

  Fly   425 LRDLRIFRIFEGTNDILRLFIA 446
            .||.||..|:|||::|.||.||
Human   382 YRDARITEIYEGTSEIQRLVIA 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7461NP_001286611.1 VLCAD 45..454 CDD:173850 131/347 (38%)
CaiA 67..446 CDD:224871 129/345 (37%)
ACADSNP_000008.1 CaiA 33..412 CDD:224871 131/347 (38%)
SCAD_SBCAD 36..408 CDD:173847 131/347 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1960
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.