DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mip40 and Lin37

DIOPT Version :9

Sequence 1:NP_611407.1 Gene:mip40 / 37215 FlyBaseID:FBgn0034430 Length:267 Species:Drosophila melanogaster
Sequence 2:XP_011249036.1 Gene:Lin37 / 75660 MGIID:1922910 Length:257 Species:Mus musculus


Alignment Length:246 Identity:64/246 - (26%)
Similarity:112/246 - (45%) Gaps:38/246 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 RGRPSKKLLIQQQQQRQYQVKLDPKVKTVTSG------SSEKP--STSSSAAAAGAGGRIKAR-- 96
            :.|.....::|...::.:..:|:|.....|:|      :.:.|  :.:...:.|..|.|..||  
Mouse    17 KARNQLDAVLQCLLEKSHMDRLEPGPAWGTTGERLDEEAGKTPLDTHNKDCSIAATGKRPSARFP 81

  Fly    97 -RVLYKKSVGAAAVAQKAP--GETYVMRLFERSLDLSKYQDKTPLYPICRAWMANQP------KN 152
             :...|:......:|:..|  ..|||::||:||:||:::.:.|||||||||||.|.|      ::
Mouse    82 HQRRKKRREMDDGLAEGGPQRSNTYVIKLFDRSVDLAQFSENTPLYPICRAWMRNSPTVRERERS 146

  Fly   153 PAVGAFQTDASLTATKREDNGEEILSQIKSGEIKVI------NQLPQAKSTDLPI-IPPRLEFSQ 210
            |.       :.|.....:..|.|:::. |:.::..:      ..|..|..:.:|. :.|..|.:.
Mouse   147 PG-------SPLPPLPEDGEGSEVINS-KNRDVYKLPPPTAPGPLGDACRSRIPSPLQPETEGTP 203

  Fly   211 EDKKREKALQGASTSDLLSSNMNRWKKVRGHWIKHIKKYEKERYEVIDKIM 261
            :|:..|..   .|.|.|:..||.|||::|..| |......:.||....||:
Mouse   204 DDEPSEPE---PSPSTLIYRNMQRWKRIRQRW-KEASHRNQLRYSESMKIL 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mip40NP_611407.1 LIN37 108..262 CDD:291952 51/169 (30%)
Lin37XP_011249036.1 LIN37 95..251 CDD:373733 51/168 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167849973
Domainoid 1 1.000 71 1.000 Domainoid score I9484
eggNOG 1 0.900 - - E1_28NIZ
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 71 1.000 Inparanoid score I5303
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48554
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007984
OrthoInspector 1 1.000 - - oto92604
orthoMCL 1 0.900 - - OOG6_108733
Panther 1 1.100 - - LDO PTHR31336
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R8951
SonicParanoid 1 1.000 - - X5933
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1514.790

Return to query results.
Submit another query.