DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mip40 and LIN37

DIOPT Version :9

Sequence 1:NP_611407.1 Gene:mip40 / 37215 FlyBaseID:FBgn0034430 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_061977.1 Gene:LIN37 / 55957 HGNCID:33234 Length:246 Species:Homo sapiens


Alignment Length:230 Identity:62/230 - (26%)
Similarity:103/230 - (44%) Gaps:36/230 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 LLIQQQQQRQYQVKLDPKVKTVTSGSSEKPSTSSSAAAAGAGGRIKAR---RVLYKKSVGAAAVA 110
            ||.:....|:   :||.:     :|.:...:.:...:.|..|.|..||   :...|:......:|
Human    29 LLEKSHMDRE---RLDEE-----AGKTPSDTHNKDCSIAATGKRPSARFPHQRRKKRREMDDGLA 85

  Fly   111 QKAP--GETYVMRLFERSLDLSKYQDKTPLYPICRAWMANQPK------NPAVGAFQTDASLTAT 167
            :..|  ..|||::||:||:||:::.:.|||||||||||.|.|.      :|:       :.|...
Human    86 EGGPQRSNTYVIKLFDRSVDLAQFSENTPLYPICRAWMRNSPSVRERECSPS-------SPLPPL 143

  Fly   168 KREDNGEEILSQIKSGEIKVINQLPQAKSTD-----LPI-IPPRLEFSQEDKKREKALQGASTSD 226
            ..::.|.|:.:.......|:....|.....|     :|. :.|.::.:.:|:..|..   .|.|.
Human   144 PEDEEGSEVTNSKSRDVYKLPPPTPPGPPGDACRSRIPSPLQPEMQGTPDDEPSEPE---PSPST 205

  Fly   227 LLSSNMNRWKKVRGHWIKHIKKYEKERYEVIDKIM 261
            |:..||.|||::|..| |......:.||....||:
Human   206 LIYRNMQRWKRIRQRW-KEASHRNQLRYSESMKIL 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mip40NP_611407.1 LIN37 108..262 CDD:291952 50/168 (30%)
LIN37NP_061977.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 37..90 11/60 (18%)
LIN37 84..240 CDD:405894 50/167 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 129..209 14/89 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165159600
Domainoid 1 1.000 74 1.000 Domainoid score I9235
eggNOG 1 0.900 - - E1_28NIZ
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 73 1.000 Inparanoid score I5292
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48554
OrthoDB 1 1.010 - - D1278998at2759
OrthoFinder 1 1.000 - - FOG0007984
OrthoInspector 1 1.000 - - oto89037
orthoMCL 1 0.900 - - OOG6_108733
Panther 1 1.100 - - LDO PTHR31336
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R8951
SonicParanoid 1 1.000 - - X5933
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.800

Return to query results.
Submit another query.