DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mip40 and lin37

DIOPT Version :9

Sequence 1:NP_611407.1 Gene:mip40 / 37215 FlyBaseID:FBgn0034430 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001017888.1 Gene:lin37 / 550587 ZFINID:ZDB-GENE-050417-446 Length:236 Species:Danio rerio


Alignment Length:248 Identity:68/248 - (27%)
Similarity:116/248 - (46%) Gaps:50/248 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 ESDLPIRGRPSKKL--LIQQQQQRQYQVKLDPKVKTVTSGSSEKPSTSSSAAAAGAGGRIKA--- 95
            ::|...|.|....|  |:::....:.|.:.|       ||.....|.:...:.:.||.|..:   
Zfish    10 KADAGARNRLDAVLQGLVERSDSEREQNEED-------SGKMVADSLAKDLSPSSAGKRPSSRFP 67

  Fly    96 --RRVLYKKSVGAAAVAQKAPGETYVMRLFERSLDLSKYQDKTPLYPICRAWMANQPKNPAVGAF 158
              ||...|:...:.:...:.....|:::||:||:||:::...|||||||||||.|   |||:   
Zfish    68 QHRRKKRKEMDDSLSETNQHKQNAYIIKLFDRSVDLAQFSTTTPLYPICRAWMRN---NPAM--- 126

  Fly   159 QTDASLTA-TKREDNGEEILSQIKSGEIKVINQLPQAKSTDLPI----------IPPRLEFSQED 212
               ...|| :....:|||.::.:.:|:.:.:.:||...|  .|:          ||| :|.:.::
Zfish   127 ---RERTAPSPPHSSGEEEMTDMLNGKGQNVYKLPPPVS--CPVSSSGEAVNLRIPP-VEKTAQN 185

  Fly   213 KKREKALQGASTSDLLSSNMNRWKKVRGHWIKHIKKYE----------KERYE 255
            :..:.|   |.||.|:.:::.||||:|..|.:...|.:          ||.||
Zfish   186 QSIDTA---AGTSTLMFNHIKRWKKIRQKWKEASSKNQLRYSESIKVLKEMYE 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mip40NP_611407.1 LIN37 108..262 CDD:291952 52/169 (31%)
lin37NP_001017888.1 LIN37 81..231 CDD:291952 48/164 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170595799
Domainoid 1 1.000 72 1.000 Domainoid score I9317
eggNOG 1 0.900 - - E1_28NIZ
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 73 1.000 Inparanoid score I5284
OMA 1 1.010 - - QHG48554
OrthoDB 1 1.010 - - D1278998at2759
OrthoFinder 1 1.000 - - FOG0007984
OrthoInspector 1 1.000 - - oto39561
orthoMCL 1 0.900 - - OOG6_108733
Panther 1 1.100 - - LDO PTHR31336
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R8951
SonicParanoid 1 1.000 - - X5933
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.