DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fkbp12 and FPR1

DIOPT Version :9

Sequence 1:NP_523792.2 Gene:Fkbp12 / 37214 FlyBaseID:FBgn0013954 Length:108 Species:Drosophila melanogaster
Sequence 2:NP_014264.1 Gene:FPR1 / 855587 SGDID:S000005079 Length:114 Species:Saccharomyces cerevisiae


Alignment Length:105 Identity:66/105 - (62%)
Similarity:83/105 - (79%) Gaps:0/105 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 VQVVPIAPGDGSTYPKNGQKVTVHYTGTLDDGTKFDSSRDRNKPFKFTIGKGEVIRGWDEGVAQL 67
            |::..|:||||:|:||.|..||:||||||::|.|||||.||..||:..||.|:||:|||.|:.:|
Yeast     9 VKIDRISPGDGATFPKTGDLVTIHYTGTLENGQKFDSSVDRGSPFQCNIGVGQVIKGWDVGIPKL 73

  Fly    68 SVGQRAKLICSPDYAYGSRGHPGVIPPNSTLTFDVELLKV 107
            |||::|:|.....||||.||.||:|||||||.||||||||
Yeast    74 SVGEKARLTIPGPYAYGPRGFPGLIPPNSTLVFDVELLKV 113

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fkbp12NP_523792.2 FkpA <2..107 CDD:223619 64/103 (62%)
FPR1NP_014264.1 FkpA <1..114 CDD:223619 66/105 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 128 1.000 Domainoid score I1162
eggNOG 1 0.900 - - E1_COG0545
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H105284
Inparanoid 1 1.050 144 1.000 Inparanoid score I1162
Isobase 1 0.950 - 0.815465 Normalized mean entropy S225
OMA 1 1.010 - - QHG53716
OrthoFinder 1 1.000 - - FOG0001019
OrthoInspector 1 1.000 - - oto99369
orthoMCL 1 0.900 - - OOG6_100299
Panther 1 1.100 - - LDO PTHR10516
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R449
SonicParanoid 1 1.000 - - X1229
TreeFam 1 0.960 - -
1514.810

Return to query results.
Submit another query.