DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fkbp12 and FPR3

DIOPT Version :9

Sequence 1:NP_523792.2 Gene:Fkbp12 / 37214 FlyBaseID:FBgn0013954 Length:108 Species:Drosophila melanogaster
Sequence 2:NP_013637.1 Gene:FPR3 / 854901 SGDID:S000004539 Length:411 Species:Saccharomyces cerevisiae


Alignment Length:107 Identity:48/107 - (44%)
Similarity:65/107 - (60%) Gaps:3/107 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GVQVVPIAPGDGSTYPKNGQKVTVHYTGTLDDGTKFDSSRDRNKPFKFTIGKGEVIRGWDEGVAQ 66
            |:.:.....||| ...|.|.:|.:.|.|.|.:|..||.:.. .|||.|.:|:||||:|||.|||.
Yeast   307 GIVIEDRTIGDG-PQAKRGARVGMRYIGKLKNGKVFDKNTS-GKPFAFKLGRGEVIKGWDIGVAG 369

  Fly    67 LSVGQRAKLICSPDYAYGSRGHPGVIPPNSTLTFDVELLKVE 108
            :|||...::|....||||.:..|| ||.||.|||||:|:.::
Yeast   370 MSVGGERRIIIPAPYAYGKQALPG-IPANSELTFDVKLVSMK 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fkbp12NP_523792.2 FkpA <2..107 CDD:223619 48/104 (46%)
FPR3NP_013637.1 NPL <118..162 CDD:407672
FkpA <287..410 CDD:223619 48/105 (46%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0545
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.