DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fkbp12 and FPR2

DIOPT Version :9

Sequence 1:NP_523792.2 Gene:Fkbp12 / 37214 FlyBaseID:FBgn0013954 Length:108 Species:Drosophila melanogaster
Sequence 2:NP_010807.3 Gene:FPR2 / 852131 SGDID:S000002927 Length:135 Species:Saccharomyces cerevisiae


Alignment Length:90 Identity:50/90 - (55%)
Similarity:62/90 - (68%) Gaps:1/90 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 GQKVTVHYTGT-LDDGTKFDSSRDRNKPFKFTIGKGEVIRGWDEGVAQLSVGQRAKLICSPDYAY 83
            |.||.|||||: |:.||.||||..|..|..|.:|.|.||:|||:|||.:.||::.||......||
Yeast    43 GDKVKVHYTGSLLESGTVFDSSYSRGSPIAFELGVGRVIKGWDQGVAGMCVGEKRKLQIPSSLAY 107

  Fly    84 GSRGHPGVIPPNSTLTFDVELLKVE 108
            |.||.||||||::.|.|||||:.|:
Yeast   108 GERGVPGVIPPSADLVFDVELVDVK 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fkbp12NP_523792.2 FkpA <2..107 CDD:223619 49/87 (56%)
FPR2NP_010807.3 FkpA <39..132 CDD:223619 49/88 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0545
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53716
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.