DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fkbp12 and FKBP6

DIOPT Version :9

Sequence 1:NP_523792.2 Gene:Fkbp12 / 37214 FlyBaseID:FBgn0013954 Length:108 Species:Drosophila melanogaster
Sequence 2:NP_003593.3 Gene:FKBP6 / 8468 HGNCID:3722 Length:327 Species:Homo sapiens


Alignment Length:99 Identity:35/99 - (35%)
Similarity:56/99 - (56%) Gaps:10/99 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 IAPGDGSTYPKNGQKVTVHYTGTLDDGTK-FDSSRDRNKPFKFTIGKGEVIRGWDEGVAQLSVGQ 71
            :|| |.|        |.|.|:|.|:...: |||:..|..|....:|:...:.|.:.|:..:..|:
Human    51 VAP-DAS--------VLVKYSGYLEHMDRPFDSNYFRKTPRLMKLGEDITLWGMELGLLSMRRGE 106

  Fly    72 RAKLICSPDYAYGSRGHPGVIPPNSTLTFDVELL 105
            .|:.:..|:||||:.|.|.:||||:|:.|::|||
Human   107 LARFLFKPNYAYGTLGCPPLIPPNTTVLFEIELL 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fkbp12NP_523792.2 FkpA <2..107 CDD:223619 35/99 (35%)
FKBP6NP_003593.3 FKBP_C 51..140 CDD:306713 33/97 (34%)
TPR <164..315 CDD:223533
TPR 1 171..204
TPR 2 219..252
TPR repeat 221..247 CDD:276809
TPR repeat 252..282 CDD:276809
TPR 3 253..286
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0545
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.