DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fkbp12 and FKBP12

DIOPT Version :9

Sequence 1:NP_523792.2 Gene:Fkbp12 / 37214 FlyBaseID:FBgn0013954 Length:108 Species:Drosophila melanogaster
Sequence 2:NP_201240.1 Gene:FKBP12 / 836556 AraportID:AT5G64350 Length:112 Species:Arabidopsis thaliana


Alignment Length:113 Identity:59/113 - (52%)
Similarity:73/113 - (64%) Gaps:6/113 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGVQVVPIAPGDGSTYPKNGQKVTVHYTGTLDDG---TKFDSSRDR-NKPFKFTIGKGEVIRGWD 61
            |||:...|.||:|.. |..||.||||.||...||   .||.|::|. .|||.|.||||.||:|||
plant     1 MGVEKQVIRPGNGPK-PAPGQTVTVHCTGFGKDGDLSQKFWSTKDEGQKPFSFQIGKGAVIKGWD 64

  Fly    62 EGVAQLSVGQRAKLICSPDYAYGSRGHPG-VIPPNSTLTFDVELLKVE 108
            |||..:.:|:.|:|.||.|||||:.|.|. .|.|||.|.|::|:|.|:
plant    65 EGVIGMQIGEVARLRCSSDYAYGAGGFPAWGIQPNSVLDFEIEVLSVQ 112

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fkbp12NP_523792.2 FkpA <2..107 CDD:223619 57/109 (52%)
FKBP12NP_201240.1 FkpA <2..111 CDD:223619 57/109 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0545
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 103 1.000 Inparanoid score I2152
OMA 1 1.010 - - QHG53716
OrthoDB 1 1.010 - - D1328688at2759
OrthoFinder 1 1.000 - - FOG0001019
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1229
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.840

Return to query results.
Submit another query.