DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fkbp12 and AT5G48570

DIOPT Version :9

Sequence 1:NP_523792.2 Gene:Fkbp12 / 37214 FlyBaseID:FBgn0013954 Length:108 Species:Drosophila melanogaster
Sequence 2:NP_199668.1 Gene:AT5G48570 / 834913 AraportID:AT5G48570 Length:578 Species:Arabidopsis thaliana


Alignment Length:89 Identity:54/89 - (60%)
Similarity:65/89 - (73%) Gaps:0/89 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 PKNGQKVTVHYTGTLDDGTKFDSSRDRNKPFKFTIGKGEVIRGWDEGVAQLSVGQRAKLICSPDY 81
            |:||.:|.|||||||.|||||||||||..|||||:|:|.||:|||.|:..:..|:.|.....|:.
plant    62 PENGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGHVIKGWDLGIKTMKKGENAIFTIPPEL 126

  Fly    82 AYGSRGHPGVIPPNSTLTFDVELL 105
            |||..|.|..||||:||.|||||:
plant   127 AYGETGSPPTIPPNATLQFDVELI 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fkbp12NP_523792.2 FkpA <2..107 CDD:223619 54/89 (61%)
AT5G48570NP_199668.1 FKBP_C 61..150 CDD:278674 53/87 (61%)
FKBP_C 174..268 CDD:278674
FKBP_C 292..390 CDD:278674
TPR_11 410..489 CDD:290150
TPR repeat 414..438 CDD:276809
TPR repeat 456..488 CDD:276809
TPR_11 463..524 CDD:290150
TPR_1 493..526 CDD:278916
TPR repeat 493..521 CDD:276809
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 119 1.000 Domainoid score I1906
eggNOG 1 0.900 - - E1_COG0545
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100299
Panther 1 1.100 - - LDO PTHR10516
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.810

Return to query results.
Submit another query.