DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fkbp12 and FKBP13

DIOPT Version :9

Sequence 1:NP_523792.2 Gene:Fkbp12 / 37214 FlyBaseID:FBgn0013954 Length:108 Species:Drosophila melanogaster
Sequence 2:NP_199380.1 Gene:FKBP13 / 834607 AraportID:AT5G45680 Length:208 Species:Arabidopsis thaliana


Alignment Length:99 Identity:44/99 - (44%)
Similarity:57/99 - (57%) Gaps:15/99 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 GQKVTVHYTGTLDDGTKFDSSRDRNKPFKFTIGKGEVIRGWDEGV-------AQLSVGQRAKLIC 77
            ||.:..||.|.|::|..||||.:|.||..|.||.||||:|||:|:       ..|:.|:|. |..
plant   109 GQLIKAHYVGKLENGKVFDSSYNRGKPLTFRIGVGEVIKGWDQGILGSDGIPPMLTGGKRT-LRI 172

  Fly    78 SPDYAYGSRGHPG------VIPPNSTLTFDVELL 105
            .|:.|||.|| .|      :|||.|.|.||:|.:
plant   173 PPELAYGDRG-AGCKGGSCLIPPASVLLFDIEYI 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fkbp12NP_523792.2 FkpA <2..107 CDD:223619 44/99 (44%)
FKBP13NP_199380.1 FkpA <88..206 CDD:223619 44/99 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0545
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1328688at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100299
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.720

Return to query results.
Submit another query.