DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fkbp12 and PnsL4

DIOPT Version :9

Sequence 1:NP_523792.2 Gene:Fkbp12 / 37214 FlyBaseID:FBgn0013954 Length:108 Species:Drosophila melanogaster
Sequence 2:NP_001329278.1 Gene:PnsL4 / 830126 AraportID:AT4G39710 Length:217 Species:Arabidopsis thaliana


Alignment Length:110 Identity:43/110 - (39%)
Similarity:55/110 - (50%) Gaps:16/110 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 GDGSTYPKNGQKVTVHYTGTLDDGTKFDSSRDRNKPFKFTIGKGEVIRGWD------EGVAQLSV 69
            |.|...|: |..|.:|||....|||.||||..|.:|....||.|:||||.|      |||..:.|
plant   104 GFGDEAPR-GVLVNIHYTARFADGTLFDSSYKRARPLTMRIGVGKVIRGLDQGILGGEGVPPMRV 167

  Fly    70 GQRAKLICSPDYAYGSRGHPG-------VIPPNSTLTFDVELLKV 107
            |.:.||...|..|||.  .|.       .||.|:||.:|:..:::
plant   168 GGKRKLQIPPKLAYGP--EPAGCFSGDCNIPGNATLLYDINFVEI 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fkbp12NP_523792.2 FkpA <2..107 CDD:223619 43/108 (40%)
PnsL4NP_001329278.1 FKBP_C 106..205 CDD:395196 41/101 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0545
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1328688at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.