DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fkbp12 and ROF1

DIOPT Version :9

Sequence 1:NP_523792.2 Gene:Fkbp12 / 37214 FlyBaseID:FBgn0013954 Length:108 Species:Drosophila melanogaster
Sequence 2:NP_001118695.1 Gene:ROF1 / 822117 AraportID:AT3G25230 Length:562 Species:Arabidopsis thaliana


Alignment Length:105 Identity:57/105 - (54%)
Similarity:72/105 - (68%) Gaps:0/105 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GVQVVPIAPGDGSTYPKNGQKVTVHYTGTLDDGTKFDSSRDRNKPFKFTIGKGEVIRGWDEGVAQ 66
            |::...:..|:|...|:||.:|.|||||||.|||||||||||..|||||:|:|:||:|||.|:..
plant    39 GLKKKLLKEGEGYETPENGDEVEVHYTGTLLDGTKFDSSRDRATPFKFTLGQGQVIKGWDIGIKT 103

  Fly    67 LSVGQRAKLICSPDYAYGSRGHPGVIPPNSTLTFDVELLK 106
            :..|:.|......:.|||..|.|..||.|:||.|||||||
plant   104 MKKGENAVFTIPAELAYGESGSPPTIPANATLQFDVELLK 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fkbp12NP_523792.2 FkpA <2..107 CDD:223619 57/105 (54%)
ROF1NP_001118695.1 FKBP_C 50..142 CDD:278674 52/91 (57%)
FKBP_C 283..380 CDD:278674
TPR_11 400..479 CDD:290150
TPR repeat 400..438 CDD:276809
TPR_11 443..514 CDD:290150
TPR repeat 443..478 CDD:276809
TPR_1 483..516 CDD:278916
TPR repeat 483..511 CDD:276809
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 119 1.000 Domainoid score I1906
eggNOG 1 0.900 - - E1_COG0545
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100299
Panther 1 1.100 - - O PTHR10516
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.810

Return to query results.
Submit another query.