DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fkbp12 and FKBP10

DIOPT Version :9

Sequence 1:NP_523792.2 Gene:Fkbp12 / 37214 FlyBaseID:FBgn0013954 Length:108 Species:Drosophila melanogaster
Sequence 2:XP_011523401.1 Gene:FKBP10 / 60681 HGNCID:18169 Length:601 Species:Homo sapiens


Alignment Length:88 Identity:43/88 - (48%)
Similarity:53/88 - (60%) Gaps:0/88 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 GQKVTVHYTGTLDDGTKFDSSRDRNKPFKFTIGKGEVIRGWDEGVAQLSVGQRAKLICSPDYAYG 84
            |..|..||.||.:||.|||||.|||......:|.|.:|.|.|.|:..:.|.:|.:||..|...||
Human    62 GDFVRYHYNGTFEDGKKFDSSYDRNTLVAIVVGVGRLITGMDRGLMGMCVNERRRLIVPPHLGYG 126

  Fly    85 SRGHPGVIPPNSTLTFDVELLKV 107
            |.|..|:|||::||.|||.||.|
Human   127 SIGLAGLIPPDATLYFDVVLLDV 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fkbp12NP_523792.2 FkpA <2..107 CDD:223619 42/86 (49%)
FKBP10XP_011523401.1 FKBP_C 55..147 CDD:278674 40/84 (48%)
FKBP_C 167..259 CDD:278674
FKBP_C 279..371 CDD:278674
FKBP_C 392..502 CDD:278674
EF-hand_7 523..587 CDD:290234
EFh 525..586 CDD:238008
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0545
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.