DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fkbp12 and FKBP7

DIOPT Version :10

Sequence 1:NP_523792.2 Gene:Fkbp12 / 37214 FlyBaseID:FBgn0013954 Length:108 Species:Drosophila melanogaster
Sequence 2:NP_851939.1 Gene:FKBP7 / 51661 HGNCID:3723 Length:222 Species:Homo sapiens


Alignment Length:102 Identity:40/102 - (39%)
Similarity:60/102 - (58%) Gaps:4/102 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 PGDGSTYPKNGQKVTVHYTGTL-DDGTKFDSSRDRNK--PFKFTIGKGEVIRGWDEGVAQLSVGQ 71
            |.:.|...|.|..:..||.|.| .||:||..||.:|:  |..|.:|.|:||:|.|..:..:..|:
Human    43 PENCSKTSKKGDLLNAHYDGYLAKDGSKFYCSRTQNEGHPKWFVLGVGQVIKGLDIAMTDMCPGE 107

  Fly    72 RAKLICSPDYAYGSRGH-PGVIPPNSTLTFDVELLKV 107
            :.|::..|.:|||..|: .|.|||::||.|::||..|
Human   108 KRKVVIPPSFAYGKEGYAEGKIPPDATLIFEIELYAV 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fkbp12NP_523792.2 FkpA 3..107 CDD:440311 39/100 (39%)
FKBP7NP_851939.1 FKBP_C 46..141 CDD:459735 36/94 (38%)
FRQ1 <127..213 CDD:444056 10/18 (56%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 200..222
Retention in the endoplasmic reticulum. /evidence=ECO:0000255|PROSITE-ProRule:PRU10138 219..222
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.