DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fkbp12 and fkbp1ab

DIOPT Version :9

Sequence 1:NP_523792.2 Gene:Fkbp12 / 37214 FlyBaseID:FBgn0013954 Length:108 Species:Drosophila melanogaster
Sequence 2:NP_001005594.1 Gene:fkbp1ab / 449552 ZFINID:ZDB-GENE-040927-9 Length:108 Species:Danio rerio


Alignment Length:108 Identity:78/108 - (72%)
Similarity:91/108 - (84%) Gaps:0/108 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGVQVVPIAPGDGSTYPKNGQKVTVHYTGTLDDGTKFDSSRDRNKPFKFTIGKGEVIRGWDEGVA 65
            |||::..|.||||.|:||.||...|||.|:|.||.||||||||:|||||.|||.||||||:|||.
Zfish     1 MGVEIETITPGDGRTFPKKGQTCVVHYVGSLTDGRKFDSSRDRDKPFKFKIGKQEVIRGWEEGVV 65

  Fly    66 QLSVGQRAKLICSPDYAYGSRGHPGVIPPNSTLTFDVELLKVE 108
            |:||||||||.||||:|||::||||:||||:||.||||||.:|
Zfish    66 QMSVGQRAKLTCSPDFAYGNKGHPGIIPPNATLIFDVELLSLE 108

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fkbp12NP_523792.2 FkpA <2..107 CDD:223619 76/104 (73%)
fkbp1abNP_001005594.1 FKBP_C 13..105 CDD:278674 68/91 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170580467
Domainoid 1 1.000 156 1.000 Domainoid score I4144
eggNOG 1 0.900 - - E1_COG0545
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 178 1.000 Inparanoid score I4017
OMA 1 1.010 - - QHG53716
OrthoDB 1 1.010 - - D1328688at2759
OrthoFinder 1 1.000 - - FOG0001019
OrthoInspector 1 1.000 - - otm24562
orthoMCL 1 0.900 - - OOG6_100299
Panther 1 1.100 - - O PTHR10516
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1229
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1413.770

Return to query results.
Submit another query.