DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fkbp12 and Fkbp39

DIOPT Version :9

Sequence 1:NP_523792.2 Gene:Fkbp12 / 37214 FlyBaseID:FBgn0013954 Length:108 Species:Drosophila melanogaster
Sequence 2:NP_524364.2 Gene:Fkbp39 / 41860 FlyBaseID:FBgn0013269 Length:357 Species:Drosophila melanogaster


Alignment Length:106 Identity:51/106 - (48%)
Similarity:65/106 - (61%) Gaps:1/106 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GVQVVPIAPGDGSTYPKNGQKVTVHYTGTLDDGTKFDSSRDRNKPFKFTIGKGEVIRGWDEGVAQ 66
            ||::|....|.|.. .|.|::|:|:|.|.|....|...|..:.|||||.:|.||||:|||.|||.
  Fly   252 GVKIVDQVVGKGEE-AKQGKRVSVYYIGRLQSNNKTFDSLLKGKPFKFALGGGEVIKGWDVGVAG 315

  Fly    67 LSVGQRAKLICSPDYAYGSRGHPGVIPPNSTLTFDVELLKV 107
            :.||.:..:.|.|..|||:||.|..|.|||||.|:|||..|
  Fly   316 MKVGGKRVITCPPHMAYGARGAPPKIGPNSTLVFEVELKAV 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fkbp12NP_523792.2 FkpA <2..107 CDD:223619 50/104 (48%)
Fkbp39NP_524364.2 FKBP_C 262..354 CDD:278674 45/92 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452513
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0545
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D96564at50557
OrthoFinder 1 1.000 - - FOG0001019
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.