DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fkbp12 and fkbp6

DIOPT Version :10

Sequence 1:NP_523792.2 Gene:Fkbp12 / 37214 FlyBaseID:FBgn0013954 Length:108 Species:Drosophila melanogaster
Sequence 2:NP_989052.1 Gene:fkbp6 / 394649 XenbaseID:XB-GENE-942472 Length:305 Species:Xenopus tropicalis


Alignment Length:105 Identity:36/105 - (34%)
Similarity:58/105 - (55%) Gaps:2/105 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GVQVVPIAPGDGSTYPKNGQKVTVHYTGTLDDGTK-FDSSRDRNKPFKFTIGKGEVIRGWDEGVA 65
            ||....|.||.|...|.:. .|.:.|:|.|:...| ||:|..|..|....:|:...:.|.:.|:.
 Frog    20 GVLKEVIRPGKGGKVPCDA-TVILKYSGYLEHADKPFDTSCYRRHPKMMKLGEDITLSGMEIGLL 83

  Fly    66 QLSVGQRAKLICSPDYAYGSRGHPGVIPPNSTLTFDVELL 105
            .:..|:.::.:.||.||||:.|...:|||::|:.|::|||
 Frog    84 TMQRGELSRFLFSPKYAYGTLGCSPLIPPSATVLFEIELL 123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fkbp12NP_523792.2 FkpA 3..107 CDD:440311 35/104 (34%)
fkbp6NP_989052.1 FKBP_C 37..123 CDD:459735 27/86 (31%)
TPR 161..>276 CDD:440225
TPR repeat 187..231 CDD:276809
TPR repeat 236..262 CDD:276809
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.