DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fkbp12 and fkbp8

DIOPT Version :10

Sequence 1:NP_523792.2 Gene:Fkbp12 / 37214 FlyBaseID:FBgn0013954 Length:108 Species:Drosophila melanogaster
Sequence 2:NP_957178.1 Gene:fkbp8 / 393858 ZFINID:ZDB-GENE-040426-1849 Length:406 Species:Danio rerio


Alignment Length:93 Identity:31/93 - (33%)
Similarity:52/93 - (55%) Gaps:5/93 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 PKNGQKVTVHYTGTLDDGTKFDSSRDRNKPFKFTIGKGEVIRGWDEGVAQLSVGQRAKLICSPDY 81
            |:.||.||:|....|.:||..|..:|    ..||:|.|:|::..|..|..:.:|::|.:..:..|
Zfish   109 PQKGQNVTIHLKTALTNGTVVDELKD----LSFTLGDGDVLQALDLTVQLMEMGEKALIEAAAKY 169

  Fly    82 AYGSRGHPG-VIPPNSTLTFDVELLKVE 108
            |||:.|... .:||::.|..:|:||..:
Zfish   170 AYGALGSSAPAVPPDADLLLEVQLLSAD 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fkbp12NP_523792.2 FkpA 3..107 CDD:440311 31/90 (34%)
fkbp8NP_957178.1 FKBP_C 106..194 CDD:459735 29/88 (33%)
Spy 161..>339 CDD:443119 12/37 (32%)
TPR repeat 214..259 CDD:276809
TPR repeat 265..293 CDD:276809
TPR repeat 298..328 CDD:276809
TPR repeat 333..361 CDD:276809
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.