DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fkbp12 and fkbp8

DIOPT Version :9

Sequence 1:NP_523792.2 Gene:Fkbp12 / 37214 FlyBaseID:FBgn0013954 Length:108 Species:Drosophila melanogaster
Sequence 2:NP_957178.1 Gene:fkbp8 / 393858 ZFINID:ZDB-GENE-040426-1849 Length:406 Species:Danio rerio


Alignment Length:93 Identity:31/93 - (33%)
Similarity:52/93 - (55%) Gaps:5/93 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 PKNGQKVTVHYTGTLDDGTKFDSSRDRNKPFKFTIGKGEVIRGWDEGVAQLSVGQRAKLICSPDY 81
            |:.||.||:|....|.:||..|..:|    ..||:|.|:|::..|..|..:.:|::|.:..:..|
Zfish   109 PQKGQNVTIHLKTALTNGTVVDELKD----LSFTLGDGDVLQALDLTVQLMEMGEKALIEAAAKY 169

  Fly    82 AYGSRGHPG-VIPPNSTLTFDVELLKVE 108
            |||:.|... .:||::.|..:|:||..:
Zfish   170 AYGALGSSAPAVPPDADLLLEVQLLSAD 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fkbp12NP_523792.2 FkpA <2..107 CDD:223619 31/90 (34%)
fkbp8NP_957178.1 FKBP_C 106..194 CDD:278674 29/88 (33%)
TPR_11 214..296 CDD:290150
TPR repeat 214..259 CDD:276809
TPR repeat 265..293 CDD:276809
TPR_11 266..330 CDD:290150
TPR repeat 298..328 CDD:276809
TPR_1 299..332 CDD:278916
TPR repeat 333..361 CDD:276809
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0545
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.