DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fkbp12 and fkbp10b

DIOPT Version :9

Sequence 1:NP_523792.2 Gene:Fkbp12 / 37214 FlyBaseID:FBgn0013954 Length:108 Species:Drosophila melanogaster
Sequence 2:NP_001122138.1 Gene:fkbp10b / 324381 ZFINID:ZDB-GENE-030131-3101 Length:614 Species:Danio rerio


Alignment Length:90 Identity:35/90 - (38%)
Similarity:53/90 - (58%) Gaps:0/90 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 KNGQKVTVHYTGTLDDGTKFDSSRDRNKPFKFTIGKGEVIRGWDEGVAQLSVGQRAKLICSPDYA 82
            |:|..|..||.||..||.:||||.:|...|...:|:...|.|.|:|:..:.:.:|.|:...|..|
Zfish    92 KSGDFVRYHYNGTFTDGKRFDSSYERGTAFFGQVGQRWQIAGVDKGILGMCINERRKITVPPHLA 156

  Fly    83 YGSRGHPGVIPPNSTLTFDVELLKV 107
            :||:|....:||::||.||:.||.:
Zfish   157 HGSKGAGDTVPPDTTLVFDLVLLDI 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fkbp12NP_523792.2 FkpA <2..107 CDD:223619 35/88 (40%)
fkbp10bNP_001122138.1 FKBP_C 87..179 CDD:278674 33/86 (38%)
FKBP_C 199..290 CDD:278674
FKBP_C 311..403 CDD:278674
FKBP_C 423..514 CDD:278674
EF-hand_7 537..599 CDD:290234
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0545
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.