DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fkbp12 and Fkbp3

DIOPT Version :9

Sequence 1:NP_523792.2 Gene:Fkbp12 / 37214 FlyBaseID:FBgn0013954 Length:108 Species:Drosophila melanogaster
Sequence 2:NP_001100206.2 Gene:Fkbp3 / 299104 RGDID:1304992 Length:224 Species:Rattus norvegicus


Alignment Length:106 Identity:49/106 - (46%)
Similarity:68/106 - (64%) Gaps:8/106 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 GDGSTYPKNGQKVTVHYTGTLDDGTKFD------SSRDRN-KPFKFTIGKGEVIRGWDEGVAQLS 68
            ||.:.:||.|..|...|||||.|||.||      |.:.:| ||..|.:|.|:|||||||.:..:|
  Rat   119 GDKTNFPKKGDVVHCWYTGTLPDGTVFDTNIQTSSKKKKNAKPLSFKVGVGKVIRGWDEALLTMS 183

  Fly    69 VGQRAKLICSPDYAYGSRGHPGV-IPPNSTLTFDVELLKVE 108
            .|::|:|...|::|||.:|.|.. ||||:.|.|:|||:.::
  Rat   184 KGEKARLEIEPEWAYGKKGQPDAKIPPNTKLIFEVELVDID 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fkbp12NP_523792.2 FkpA <2..107 CDD:223619 49/103 (48%)
Fkbp3NP_001100206.2 BTHB 6..76 CDD:408209
FKBP_C 124..221 CDD:395196 46/96 (48%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0545
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1328688at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.