Sequence 1: | NP_523792.2 | Gene: | Fkbp12 / 37214 | FlyBaseID: | FBgn0013954 | Length: | 108 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001099955.2 | Gene: | Fkbp7 / 295672 | RGDID: | 1305293 | Length: | 218 | Species: | Rattus norvegicus |
Alignment Length: | 102 | Identity: | 41/102 - (40%) |
---|---|---|---|
Similarity: | 56/102 - (54%) | Gaps: | 4/102 - (3%) |
- Green bases have known domain annotations that are detailed below.
Fly 10 PGDGSTYPKNGQKVTVHYTGTL-DDGTKFDSSR--DRNKPFKFTIGKGEVIRGWDEGVAQLSVGQ 71
Fly 72 RAKLICSPDYAYGSRGH-PGVIPPNSTLTFDVELLKV 107 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Fkbp12 | NP_523792.2 | FkpA | <2..107 | CDD:223619 | 40/100 (40%) |
Fkbp7 | NP_001099955.2 | FKBP_C | 42..137 | CDD:278674 | 37/94 (39%) |
EF-hand_7 | 148..210 | CDD:290234 | |||
EFh | 148..209 | CDD:298682 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0545 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.810 |