DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fkbp12 and SPAC27F1.06c

DIOPT Version :9

Sequence 1:NP_523792.2 Gene:Fkbp12 / 37214 FlyBaseID:FBgn0013954 Length:108 Species:Drosophila melanogaster
Sequence 2:NP_594535.1 Gene:SPAC27F1.06c / 2541479 PomBaseID:SPAC27F1.06c Length:362 Species:Schizosaccharomyces pombe


Alignment Length:97 Identity:42/97 - (43%)
Similarity:55/97 - (56%) Gaps:3/97 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 GDGSTYPKNGQKVTVHYTGTLDDGTKFDSSRDRNKPFKFTIGKGEVIRGWDEGVAQLSVGQRAKL 75
            |||.. .|..::|::.|.|.|.:|..||.: ...|||.|.:|..|||:|||.|:..:.||....:
pombe   268 GDGPA-AKRKKRVSMRYIGRLTNGKVFDKN-ITGKPFTFNLGLEEVIKGWDVGIVGMQVGGERTI 330

  Fly    76 ICSPDYAYGSRGHPGVIPPNSTLTFDVELLKV 107
            ......||||:..|| ||.||.|.|||:||.|
pombe   331 HIPAAMAYGSKRLPG-IPANSDLVFDVKLLAV 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fkbp12NP_523792.2 FkpA <2..107 CDD:223619 41/95 (43%)
SPAC27F1.06cNP_594535.1 FkpA 152..362 CDD:223619 42/97 (43%)
FKBP_C 272..359 CDD:278674 36/89 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0545
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10516
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.