DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fkbp12 and fkh1

DIOPT Version :9

Sequence 1:NP_523792.2 Gene:Fkbp12 / 37214 FlyBaseID:FBgn0013954 Length:108 Species:Drosophila melanogaster
Sequence 2:NP_595257.1 Gene:fkh1 / 2541195 PomBaseID:SPBC839.17c Length:112 Species:Schizosaccharomyces pombe


Alignment Length:107 Identity:65/107 - (60%)
Similarity:83/107 - (77%) Gaps:0/107 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGVQVVPIAPGDGSTYPKNGQKVTVHYTGTLDDGTKFDSSRDRNKPFKFTIGKGEVIRGWDEGVA 65
            |||:...|:.|:|..:||.|.::|:||||||.:|.|||||.||..||..|||.|::||||||||.
pombe     1 MGVEKQVISSGNGQDFPKPGDRITMHYTGTLTNGKKFDSSVDRGSPFVCTIGVGQLIRGWDEGVP 65

  Fly    66 QLSVGQRAKLICSPDYAYGSRGHPGVIPPNSTLTFDVELLKV 107
            ::|:|::|||..:|||.||.||.||:|||||||.||||||.:
pombe    66 KMSLGEKAKLTITPDYGYGPRGFPGLIPPNSTLLFDVELLAI 107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fkbp12NP_523792.2 FkpA <2..107 CDD:223619 64/104 (62%)
fkh1NP_595257.1 FkpA <2..108 CDD:223619 64/106 (60%)
FKBP_C 13..105 CDD:278674 58/91 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 132 1.000 Domainoid score I1310
eggNOG 1 0.900 - - E1_COG0545
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H105284
Inparanoid 1 1.050 143 1.000 Inparanoid score I1350
OMA 1 1.010 - - QHG53716
OrthoFinder 1 1.000 - - FOG0001019
OrthoInspector 1 1.000 - - oto100950
orthoMCL 1 0.900 - - OOG6_100299
Panther 1 1.100 - - LDO PTHR10516
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R449
SonicParanoid 1 1.000 - - X1229
TreeFam 1 0.960 - -
1413.860

Return to query results.
Submit another query.