powered by:
Protein Alignment Fkbp12 and CG30075
DIOPT Version :9
Sequence 1: | NP_523792.2 |
Gene: | Fkbp12 / 37214 |
FlyBaseID: | FBgn0013954 |
Length: | 108 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_725390.1 |
Gene: | CG30075 / 246437 |
FlyBaseID: | FBgn0050075 |
Length: | 195 |
Species: | Drosophila melanogaster |
Alignment Length: | 40 |
Identity: | 11/40 - (27%) |
Similarity: | 17/40 - (42%) |
Gaps: | 3/40 - (7%) |
- Green bases have known domain annotations that are detailed below.
Fly 10 PGD--GSTYPKNGQKVTVHYTGTLDDGTKFDSSRDRNKPF 47
|.| |....|| .|.:.|.....:|..:..||.:::..|
Fly 3 PNDKKGFKAAKN-DKFSTHALLNENDNDQSLSSDEQDDIF 41
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Fkbp12 | NP_523792.2 |
FkpA |
<2..107 |
CDD:223619 |
11/40 (28%) |
CG30075 | NP_725390.1 |
None |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG0545 |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.