DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fkbp12 and fkb-2

DIOPT Version :9

Sequence 1:NP_523792.2 Gene:Fkbp12 / 37214 FlyBaseID:FBgn0013954 Length:108 Species:Drosophila melanogaster
Sequence 2:NP_001021722.1 Gene:fkb-2 / 173160 WormBaseID:WBGene00001427 Length:108 Species:Caenorhabditis elegans


Alignment Length:107 Identity:66/107 - (61%)
Similarity:77/107 - (71%) Gaps:0/107 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGVQVVPIAPGDGSTYPKNGQKVTVHYTGTLDDGTKFDSSRDRNKPFKFTIGKGEVIRGWDEGVA 65
            |||....:..||..|.|||||.||.||..||::|.|.||||||..||||.|||||||:|||:|||
 Worm     1 MGVDRQILVEGDNVTKPKNGQTVTCHYVLTLENGKKIDSSRDRGTPFKFKIGKGEVIKGWDQGVA 65

  Fly    66 QLSVGQRAKLICSPDYAYGSRGHPGVIPPNSTLTFDVELLKV 107
            |:|||:::||..|.|..||.||.|..||.|:||.|:||||.|
 Worm    66 QMSVGEKSKLTISADLGYGPRGVPPQIPANATLVFEVELLGV 107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fkbp12NP_523792.2 FkpA <2..107 CDD:223619 64/104 (62%)
fkb-2NP_001021722.1 FKBP_C 15..105 CDD:278674 58/89 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 124 1.000 Domainoid score I3418
eggNOG 1 0.900 - - E1_COG0545
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H105284
Inparanoid 1 1.050 133 1.000 Inparanoid score I3169
Isobase 1 0.950 - 0.815465 Normalized mean entropy S225
OMA 1 1.010 - - QHG53716
OrthoDB 1 1.010 - - D1328688at2759
OrthoFinder 1 1.000 - - FOG0001019
OrthoInspector 1 1.000 - - otm14751
orthoMCL 1 0.900 - - OOG6_100299
Panther 1 1.100 - - LDO PTHR10516
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R449
SonicParanoid 1 1.000 - - X1229
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1514.860

Return to query results.
Submit another query.