DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fkbp12 and Fkbp7

DIOPT Version :9

Sequence 1:NP_523792.2 Gene:Fkbp12 / 37214 FlyBaseID:FBgn0013954 Length:108 Species:Drosophila melanogaster
Sequence 2:NP_034352.1 Gene:Fkbp7 / 14231 MGIID:1336879 Length:218 Species:Mus musculus


Alignment Length:102 Identity:41/102 - (40%)
Similarity:57/102 - (55%) Gaps:4/102 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 PGDGSTYPKNGQKVTVHYTGTL-DDGTKFDSSR--DRNKPFKFTIGKGEVIRGWDEGVAQLSVGQ 71
            |.:.|...:.|..:..||.|.| .||:||..||  |...|..|.:|.|.||:|.|..:..:..|:
Mouse    39 PENCSKTSRKGDLLNAHYDGYLAKDGSKFYCSRTQDEGHPKWFVLGVGHVIKGLDIAMMDMCPGE 103

  Fly    72 RAKLICSPDYAYGSRGH-PGVIPPNSTLTFDVELLKV 107
            :.|:|..|.:|||..|: .|.||||:||.|::||..|
Mouse   104 KRKVIIPPSFAYGKEGYAEGKIPPNATLMFEIELYAV 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fkbp12NP_523792.2 FkpA <2..107 CDD:223619 40/100 (40%)
Fkbp7NP_034352.1 FKBP_C 42..137 CDD:278674 37/94 (39%)
EF-hand_7 148..210 CDD:290234
EFh 148..209 CDD:298682
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 197..218
Prevents secretion from ER. /evidence=ECO:0000255|PROSITE-ProRule:PRU10138 215..218
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0545
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.