DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fkbp12 and Fkbp10

DIOPT Version :9

Sequence 1:NP_523792.2 Gene:Fkbp12 / 37214 FlyBaseID:FBgn0013954 Length:108 Species:Drosophila melanogaster
Sequence 2:NP_034351.2 Gene:Fkbp10 / 14230 MGIID:104769 Length:581 Species:Mus musculus


Alignment Length:88 Identity:42/88 - (47%)
Similarity:53/88 - (60%) Gaps:0/88 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 GQKVTVHYTGTLDDGTKFDSSRDRNKPFKFTIGKGEVIRGWDEGVAQLSVGQRAKLICSPDYAYG 84
            |..|..||.||.:||.|||||.||:......:|.|.:|.|.|.|:..:.|.:|.:||..|...||
Mouse    61 GDFVRYHYNGTFEDGKKFDSSYDRSTLVAIVVGVGRLITGMDRGLMGMCVNERRRLIVPPHLGYG 125

  Fly    85 SRGHPGVIPPNSTLTFDVELLKV 107
            |.|..|:|||::||.|||.||.|
Mouse   126 SIGVAGLIPPDATLYFDVVLLDV 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fkbp12NP_523792.2 FkpA <2..107 CDD:223619 41/86 (48%)
Fkbp10NP_034351.2 FKBP_C 54..146 CDD:278674 39/84 (46%)
FKBP_C 166..258 CDD:278674
FKBP_C 278..370 CDD:278674
FKBP_C 391..482 CDD:278674
EF-hand_7 504..567 CDD:290234
EFh 505..566 CDD:238008
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 533..581
Prevents secretion from ER. /evidence=ECO:0000255|PROSITE-ProRule:PRU10138 578..581
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0545
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.