DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fkbp12 and Fkbp1b

DIOPT Version :9

Sequence 1:NP_523792.2 Gene:Fkbp12 / 37214 FlyBaseID:FBgn0013954 Length:108 Species:Drosophila melanogaster
Sequence 2:NP_058559.3 Gene:Fkbp1b / 14226 MGIID:1336205 Length:108 Species:Mus musculus


Alignment Length:108 Identity:76/108 - (70%)
Similarity:90/108 - (83%) Gaps:0/108 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGVQVVPIAPGDGSTYPKNGQKVTVHYTGTLDDGTKFDSSRDRNKPFKFTIGKGEVIRGWDEGVA 65
            |||::..|:||||.|:||.||...|||||.|.:|.||||||||||||||.|||.|||:|::||.|
Mouse     1 MGVEIETISPGDGRTFPKKGQICVVHYTGMLQNGKKFDSSRDRNKPFKFRIGKQEVIKGFEEGTA 65

  Fly    66 QLSVGQRAKLICSPDYAYGSRGHPGVIPPNSTLTFDVELLKVE 108
            |:|:||||||.|:||.|||:.|||||||||:||.||||||.:|
Mouse    66 QMSLGQRAKLTCTPDVAYGATGHPGVIPPNATLIFDVELLSLE 108

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fkbp12NP_523792.2 FkpA <2..107 CDD:223619 74/104 (71%)
Fkbp1bNP_058559.3 FKBP_C 13..105 CDD:306713 66/91 (73%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167836941
Domainoid 1 1.000 155 1.000 Domainoid score I4226
eggNOG 1 0.900 - - E1_COG0545
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 179 1.000 Inparanoid score I4000
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53716
OrthoDB 1 1.010 - - D1328688at2759
OrthoFinder 1 1.000 - - FOG0001019
OrthoInspector 1 1.000 - - otm43017
orthoMCL 1 0.900 - - OOG6_100299
Panther 1 1.100 - - LDO PTHR10516
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R449
SonicParanoid 1 1.000 - - X1229
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.800

Return to query results.
Submit another query.