DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fkbp12 and Fkbp1a

DIOPT Version :9

Sequence 1:NP_523792.2 Gene:Fkbp12 / 37214 FlyBaseID:FBgn0013954 Length:108 Species:Drosophila melanogaster
Sequence 2:NP_001289007.1 Gene:Fkbp1a / 14225 MGIID:95541 Length:150 Species:Mus musculus


Alignment Length:80 Identity:64/80 - (80%)
Similarity:73/80 - (91%) Gaps:0/80 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 GTLDDGTKFDSSRDRNKPFKFTIGKGEVIRGWDEGVAQLSVGQRAKLICSPDYAYGSRGHPGVIP 93
            |.|:||.|||||||||||||||:||.||||||:|||||:|||||||||.|.|||||:.||||:||
Mouse    71 GMLEDGKKFDSSRDRNKPFKFTLGKQEVIRGWEEGVAQMSVGQRAKLIISSDYAYGATGHPGIIP 135

  Fly    94 PNSTLTFDVELLKVE 108
            |::||.|||||||:|
Mouse   136 PHATLVFDVELLKLE 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fkbp12NP_523792.2 FkpA <2..107 CDD:223619 62/77 (81%)
Fkbp1aNP_001289007.1 FKBP_C 71..147 CDD:306713 60/75 (80%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167836940
Domainoid 1 1.000 155 1.000 Domainoid score I4226
eggNOG 1 0.900 - - E1_COG0545
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 179 1.000 Inparanoid score I4000
Isobase 1 0.950 - 0.815465 Normalized mean entropy S225
OMA 1 1.010 - - QHG53716
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001019
OrthoInspector 1 1.000 - - otm43017
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10516
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R449
SonicParanoid 1 1.000 - - X1229
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1514.840

Return to query results.
Submit another query.