DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fkbp12 and Fkbp12

DIOPT Version :10

Sequence 1:NP_523792.2 Gene:Fkbp12 / 37214 FlyBaseID:FBgn0013954 Length:108 Species:Drosophila melanogaster
Sequence 2:XP_061517035.1 Gene:Fkbp12 / 1280504 VectorBaseID:AGAMI1_011056 Length:108 Species:Anopheles gambiae


Alignment Length:108 Identity:89/108 - (82%)
Similarity:98/108 - (90%) Gaps:0/108 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGVQVVPIAPGDGSTYPKNGQKVTVHYTGTLDDGTKFDSSRDRNKPFKFTIGKGEVIRGWDEGVA 65
            ||||:||||.||.:|:||.||...|||||||||||.|||||.|.|||||::||||||||||||||
Mosquito     1 MGVQIVPIANGDQTTFPKPGQTAVVHYTGTLDDGTVFDSSRTRGKPFKFSVGKGEVIRGWDEGVA 65

  Fly    66 QLSVGQRAKLICSPDYAYGSRGHPGVIPPNSTLTFDVELLKVE 108
            |:||||||||:|||||||||||||||||||:.||||||||:||
Mosquito    66 QMSVGQRAKLVCSPDYAYGSRGHPGVIPPNARLTFDVELLRVE 108

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fkbp12NP_523792.2 FkpA 3..107 CDD:440311 85/103 (83%)
Fkbp12XP_061517035.1 None

Return to query results.
Submit another query.