DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fkbp12 and fkbp4

DIOPT Version :9

Sequence 1:NP_523792.2 Gene:Fkbp12 / 37214 FlyBaseID:FBgn0013954 Length:108 Species:Drosophila melanogaster
Sequence 2:XP_012810222.1 Gene:fkbp4 / 100379681 XenbaseID:XB-GENE-948088 Length:450 Species:Xenopus tropicalis


Alignment Length:94 Identity:53/94 - (56%)
Similarity:66/94 - (70%) Gaps:0/94 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 GDGSTYPKNGQKVTVHYTGTLDDGTKFDSSRDRNKPFKFTIGKGEVIRGWDEGVAQLSVGQRAKL 75
            |.|...|..|.||:|||||.|.|||:|||||||...|.|.:||||||:.||..||.:.||:..::
 Frog    37 GTGENTPMIGDKVSVHYTGWLTDGTQFDSSRDRKDKFTFDLGKGEVIKAWDIAVATMKVGEICQI 101

  Fly    76 ICSPDYAYGSRGHPGVIPPNSTLTFDVEL 104
            :|.|:||||:.|.|..||||:.|.|:|||
 Frog   102 VCKPEYAYGTSGSPPKIPPNAVLVFEVEL 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fkbp12NP_523792.2 FkpA <2..107 CDD:223619 53/94 (56%)
fkbp4XP_012810222.1 FKBP_C 39..130 CDD:365980 50/90 (56%)
FKBP_C 156..246 CDD:365980
TPR <237..380 CDD:223533
TPR repeat 270..294 CDD:276809
TPR repeat 307..344 CDD:276809
TPR repeat 349..377 CDD:276809
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.