DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fkbp12 and fkbp9

DIOPT Version :9

Sequence 1:NP_523792.2 Gene:Fkbp12 / 37214 FlyBaseID:FBgn0013954 Length:108 Species:Drosophila melanogaster
Sequence 2:NP_001123385.1 Gene:fkbp9 / 100125793 XenbaseID:XB-GENE-1019523 Length:585 Species:Xenopus tropicalis


Alignment Length:113 Identity:45/113 - (39%)
Similarity:58/113 - (51%) Gaps:12/113 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 PIAPGDGSTYPK------------NGQKVTVHYTGTLDDGTKFDSSRDRNKPFKFTIGKGEVIRG 59
            |..|||.....|            .|..|..||.||..||||||||.||...:...:|||::|.|
 Frog    42 PPVPGDQLHIEKRWVPDTCQRHVTEGDFVRYHYHGTFPDGTKFDSSYDRGSTYNVFVGKGQIIAG 106

  Fly    60 WDEGVAQLSVGQRAKLICSPDYAYGSRGHPGVIPPNSTLTFDVELLKV 107
            .|:.:..:.|.:|..:...|..||||:|...||||::.|.|||.||.:
 Frog   107 MDKALLGMCVNERRFVKIPPSLAYGSKGLADVIPPDAVLHFDVLLLDI 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fkbp12NP_523792.2 FkpA <2..107 CDD:223619 45/111 (41%)
fkbp9NP_001123385.1 FKBP_C 60..152 CDD:365980 38/91 (42%)
FKBP_C 172..264 CDD:365980
FKBP_C 284..375 CDD:365980
FKBP_C 395..487 CDD:365980
EFh 510..571 CDD:238008
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.