DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AANATL4 and AANAT1

DIOPT Version :9

Sequence 1:NP_611406.1 Gene:AANATL4 / 37213 FlyBaseID:FBgn0034429 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_995934.1 Gene:AANAT1 / 37867 FlyBaseID:FBgn0019643 Length:275 Species:Drosophila melanogaster


Alignment Length:224 Identity:62/224 - (27%)
Similarity:102/224 - (45%) Gaps:31/224 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 TIRIMRPEDYAQVKAYMEAEYYTSEPL--------CQSSGEPVHQQNEEINDAFNQSIIAEGTSL 66
            ||.:::|||...|.|.::..::..|||        |:..            :.::...:.:..|.
  Fly    58 TIELIQPEDGEAVIAMLKTFFFKDEPLNTFLDLGECKEL------------EKYSLKPLPDNCSY 110

  Fly    67 LALDENDGGRIVGLV---LACASYPDNVNAGTLNLKLENVEDNAWGRMYHLLMKAKREVNLFERY 128
            .|:  |..|.|:|:.   |.....||:|.    ....::.|...:.::..|:...:.:.|:|:.|
  Fly   111 KAV--NKKGEIIGVFLNGLMRRPSPDDVP----EKAADSCEHPKFKKILSLMDHVEEQFNIFDVY 169

  Fly   129 -DIPKALYSHVTSVASWKRGKGLGSRLAATLMELGRSNGFPLMMAFCTSFYSARQKGALGMECIY 192
             |....|...:.||.:..||.|:..||.....|..|.||..:....|:|.||||....||...::
  Fly   170 PDEELILDGKILSVDTNYRGLGIAGRLTERAYEYMRENGINVYHVLCSSHYSARVMEKLGFHEVF 234

  Fly   193 SIDYADYKDDEGRVIFTPAAPHTKLRVMA 221
            .:.:|||| .:|.|:|.|||||..::|||
  Fly   235 RMQFADYK-PQGEVVFKPAAPHVGIQVMA 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AANATL4NP_611406.1 None
AANAT1NP_995934.1 RimI <168..235 CDD:223532 22/66 (33%)
NAT_SF <183..227 CDD:302625 16/43 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435024
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 57 1.000 Inparanoid score I4040
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1185856at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20905
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
55.000

Return to query results.
Submit another query.