DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AANATL4 and AANATL2

DIOPT Version :9

Sequence 1:NP_611406.1 Gene:AANATL4 / 37213 FlyBaseID:FBgn0034429 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_001285667.1 Gene:AANATL2 / 33874 FlyBaseID:FBgn0031791 Length:216 Species:Drosophila melanogaster


Alignment Length:226 Identity:76/226 - (33%)
Similarity:124/226 - (54%) Gaps:17/226 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 IDGVTIRIMRPEDYAQVKAYMEAEYYTSEPLCQSSGEPVHQQNEEINDA---FNQSIIAEGTSLL 67
            :..:|||.|...||.:|:|::...::..|||.....|...|  .|::.|   .::|:|.:..||:
  Fly     1 MSAITIRAMTIGDYEEVEAFLAVHFFKQEPLMLIPQEDPKQ--SEVSSAEAELHRSLIPQDLSLV 63

  Fly    68 ALDENDGGRIVGLVLACASYPDNVNAGTLNLKLENVEDN----AWGRMYHLLMKAKREVNLFERY 128
            |:   ||.||||:|||....|::     |..:.:..|..    ...:::..|...:|:.|:|:.|
  Fly    64 AV---DGERIVGVVLAGELVPED-----LEREYQEAEQKEITCLLDKIHKFLAGIERQANIFKHY 120

  Fly   129 DIPKALYSHVTSVASWKRGKGLGSRLAATLMELGRSNGFPLMMAFCTSFYSARQKGALGMECIYS 193
            .:.:|||.::..|....|.:.:|:||....:||||..|||::.:.|::..|.|...||.||||.:
  Fly   121 GVERALYLYMLGVDVSIRRQRVGTRLVEATIELGRQRGFPVVTSTCSNQNSKRLMTALNMECILT 185

  Fly   194 IDYADYKDDEGRVIFTPAAPHTKLRVMAIKL 224
            .|||||||:.|.::...:.|||...|:||:|
  Fly   186 KDYADYKDEHGEIVLRASEPHTSASVVAIRL 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AANATL4NP_611406.1 None
AANATL2NP_001285667.1 NAT_SF 114..163 CDD:173926 18/48 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435014
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2E94Y
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 78 1.000 Inparanoid score I7474
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D108272at50557
OrthoFinder 1 1.000 - - FOG0007623
OrthoInspector 1 1.000 - - mtm9663
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20905
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.900

Return to query results.
Submit another query.