DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AANATL4 and AgmNAT

DIOPT Version :9

Sequence 1:NP_611406.1 Gene:AANATL4 / 37213 FlyBaseID:FBgn0034429 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_572268.1 Gene:AgmNAT / 31512 FlyBaseID:FBgn0029813 Length:216 Species:Drosophila melanogaster


Alignment Length:224 Identity:65/224 - (29%)
Similarity:101/224 - (45%) Gaps:8/224 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTPTTIDGVTIRIMRPEDYAQVKAYMEAEYYTSEPLCQSSGEPVHQQNEEINDAFNQSIIAEGTS 65
            |.....|.:.:|.:...:..|:..::.|.||..|||...:..|   :.|..:..|..|.:..||.
  Fly     1 MAKPIADDIVVRQVDVGETEQLMTFLLAHYYPEEPLTAGTHPP---EPEAADKEFLLSNVPFGTC 62

  Fly    66 LLALDENDGGRIVGLVLACASYPDNVNAGTLNLKLENVEDNAWGRMYHLLMKAKREVNLFERYDI 130
            .:||.|   ||||..|:  |...|:.....:..:........||.:.|||...:...::..|:.:
  Fly    63 FVALHE---GRIVAAVV--AGPKDSHEPEHMAEEARKYAGGKWGSILHLLSAVETATDVCRRFSV 122

  Fly   131 PKALYSHVTSVASWKRGKGLGSRLAATLMELGRSNGFPLMMAFCTSFYSARQKGALGMECIYSID 195
            |..|:.|...|....||:.||.||..|:.:.||..|..|:...|||.||||....||.:.|.::.
  Fly   123 PSCLHVHALGVDPQLRGRNLGGRLMETVAQRGRDLGHQLVSVDCTSVYSARLVQRLGYQLINTLR 187

  Fly   196 YADYKDDEGRVIFTPAAPHTKLRVMAIKL 224
            |.|:.|..|:.:..|..||..::...:.|
  Fly   188 YVDHLDASGQQVIRPPPPHESVQTFVLHL 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AANATL4NP_611406.1 None
AgmNATNP_572268.1 Acetyltransf_1 33..180 CDD:306954 48/154 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435019
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2E94Y
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 78 1.000 Inparanoid score I7474
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D100876at33392
OrthoFinder 1 1.000 - - FOG0007623
OrthoInspector 1 1.000 - - mtm9663
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20905
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.900

Return to query results.
Submit another query.