DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AANATL4 and W02D7.5

DIOPT Version :9

Sequence 1:NP_611406.1 Gene:AANATL4 / 37213 FlyBaseID:FBgn0034429 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_505143.2 Gene:W02D7.5 / 189117 WormBaseID:WBGene00020941 Length:232 Species:Caenorhabditis elegans


Alignment Length:226 Identity:48/226 - (21%)
Similarity:83/226 - (36%) Gaps:43/226 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 RIMRPEDYAQVKAYMEAEYYTSEPLCQSSGEPVHQQNEEINDAFNQSI---IAEGTSLLALDEND 73
            |:.:|:|...:..:::|.:...||..::    :....|.....|..::   :....|.:.|.|||
 Worm    15 RVAQPKDKENILKFLDAHFAKEEPCARA----LKLSPETSRGIFTTTVTRCLNFPFSTVVLQEND 75

  Fly    74 GGRIVGLVLACA-SYPDNVNAGTL-------NLKL-----ENVEDNAWGRMYHLLMKAKREVNLF 125
              .|...:||.. :..|.:::...       ||||     .:...|.|       ..|...||  
 Worm    76 --EIAACLLASVWNRTDPIDSADFNSSGMPENLKLFVQFINSAHSNFW-------KIAPPNVN-- 129

  Fly   126 ERYDIPKALYSHVTSVASWKRGKGLGSRLAATLM---ELGRSN-GFPLMMAFCTSFYSARQKGAL 186
                  ..::..:.|||.....||:.:|:..|.|   .|.:.| |..|......:.....||.  
 Worm   130 ------SIIHREIGSVAPQFTRKGIATRMVTTNMTKTNLKKYNIGGVLSETSSLANQIVLQKA-- 186

  Fly   187 GMECIYSIDYADYKDDEGRVIFTPAAPHTKL 217
            |.:|:..:.|:...|.:|..:..|....|.|
 Worm   187 GFKCLKELPYSAIVDSKGNRVLRPDDGTTSL 217



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 57 1.000 Inparanoid score I4040
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1185856at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR20905
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.160

Return to query results.
Submit another query.