DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AANATL4 and R13D11.4

DIOPT Version :9

Sequence 1:NP_611406.1 Gene:AANATL4 / 37213 FlyBaseID:FBgn0034429 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_503329.2 Gene:R13D11.4 / 187863 WormBaseID:WBGene00020058 Length:227 Species:Caenorhabditis elegans


Alignment Length:213 Identity:43/213 - (20%)
Similarity:82/213 - (38%) Gaps:42/213 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 EDYAQVKAYMEAEYYTSEPLCQSSGEPVHQQNEEINDAFNQSIIAEGTSLLALDENDGGRIVGLV 81
            |:.:::..::.:.:...||:.::.|.........::..|.:::....:  .||.|.|..:..   
 Worm    14 ENSSELSEFLMSHFLLEEPMNRAIGMSRENFQPFVDKLFERTLNIPFS--FALVEKDSRKFA--- 73

  Fly    82 LACA------------SYPDNVNAGTLNLKLENVEDN---AWGRMYHLLMKAKREVNLFERYDIP 131
             |||            ::.|..|.|. .....|.|..   |.|::...|.....|:.|    |:.
 Worm    74 -ACAMSSLWINEKNDVAHKDTENHGD-EFTFGNPERKDIAAVGKILTELHGKFFEICL----DVE 132

  Fly   132 KALYSHVTSVASWKRGKGLGSRLAATLMELGRSNGFPLMMAFCTSFYSARQKGALGMECIY---- 192
            :||:..:.|||...:.:||.|||.|.:.:..:...|.     |:..  |.:..:|..:|:.    
 Worm   133 QALHLEILSVAKEHQRRGLASRLMAKMEDPAKMREFK-----CSKI--ASEISSLANQCLMKKRG 190

  Fly   193 -----SIDYADYKDDEGR 205
                 ...:|...|:.||
 Worm   191 YTALTETLFASECDESGR 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AANATL4NP_611406.1 None
R13D11.4NP_503329.2 Acetyltransf_1 <130..191 CDD:366181 17/67 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2E94Y
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 57 1.000 Inparanoid score I4040
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR20905
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.050

Return to query results.
Submit another query.