DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AANATL4 and M7.12

DIOPT Version :9

Sequence 1:NP_611406.1 Gene:AANATL4 / 37213 FlyBaseID:FBgn0034429 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_502070.2 Gene:M7.12 / 187458 WormBaseID:WBGene00010887 Length:241 Species:Caenorhabditis elegans


Alignment Length:83 Identity:15/83 - (18%)
Similarity:36/83 - (43%) Gaps:8/83 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 PTTIDGVTIRIMRPEDYAQVKAYMEAEYYTSEPLCQSSGEPVHQQNEEINDAFN---QSIIAEGT 64
            |.:.:......::.::..:|..::...:...|||.:::|    ....:|...|:   :.::....
 Worm    18 PASTEKYYFETVKHDNRNEVVDFLNNNFRVEEPLSKAAG----MTESDIQSCFDGVFERVLKNEV 78

  Fly    65 SLLALDENDGGRIVGLVL 82
            |:||..: ....|||.:|
 Worm    79 SILARSK-QSDEIVGCML 95



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2E94Y
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 57 1.000 Inparanoid score I4040
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR20905
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.960

Return to query results.
Submit another query.